Protein Info for CA265_RS15145 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: amino acid permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 649 transmembrane" amino acids 38 to 58 (21 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 205 to 226 (22 residues), see Phobius details amino acids 238 to 258 (21 residues), see Phobius details amino acids 270 to 288 (19 residues), see Phobius details amino acids 309 to 331 (23 residues), see Phobius details amino acids 351 to 374 (24 residues), see Phobius details amino acids 405 to 426 (22 residues), see Phobius details amino acids 432 to 449 (18 residues), see Phobius details amino acids 469 to 487 (19 residues), see Phobius details amino acids 576 to 593 (18 residues), see Phobius details amino acids 599 to 617 (19 residues), see Phobius details amino acids 623 to 639 (17 residues), see Phobius details PF13520: AA_permease_2" amino acids 33 to 485 (453 residues), 209.9 bits, see alignment E=1.4e-65 PF00324: AA_permease" amino acids 39 to 508 (470 residues), 107.5 bits, see alignment E=1.5e-34 PF03845: Spore_permease" amino acids 216 to 329 (114 residues), 24.1 bits, see alignment E=3.2e-09 PF13906: AA_permease_C" amino acids 599 to 642 (44 residues), 40.9 bits, see alignment 3.7e-14

Best Hits

KEGG orthology group: None (inferred from 81% identity to phe:Phep_0973)

Predicted SEED Role

"Amino acid transporters"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z6P3 at UniProt or InterPro

Protein Sequence (649 amino acids)

>CA265_RS15145 amino acid permease (Pedobacter sp. GW460-11-11-14-LB5)
MFEKLFRKKSISKILQDAAKGYGDHENTLHKTLGVRDLTAFGIAAIIGAGIFSTIGKASA
DGGPAVIFLFIFTAVACSFAAFAYAEFASMVPVSGSAYTYSYVAFGELVAWIIGWSLIME
YSIGNITVAISWSDYFTGLLSTIKIPPLGIEGIHVPDWMTMDYLSAYNGHKHAEALLAAG
KNLADLDSATALANNAWLTAPKIGSFHLVADIPALGIIILITWLIYRGMKESRNASNAMV
VVKLAVILLVLAVGIFYVDTKNWDPFAPNGVSGVLKGVSAVFFAYIGFDAISTTAEECKN
PQRDLPRGMMWAIIICTILYVAIALVLTGIVKSDTLAVGDPLAFVFDQINLKLMSGIIAV
SAVFAMASVLLVFQMGQPRIWMSMSRDGLLPKSFSKIHPKYKTPSFATIVVGFVVAVPSL
FMNLTIVTDLCSIGTLFAFVLVCAGVLVLQNRPDVQRGKFKIPYVNSKFIIPVVLIATII
FAFTKYGKETKAFFFNSPKTIQTVTFVTSLSGDELKIVKEEIVKNAAPQIILAEKVDAES
YLSALPADRYEQFISASKVPVEKKYESGWGLFKHKIPMWIFLIICVIITYYCITKNLSLI
PVLGLISCLYMMCELGISNWIGFGIWLVVGLVVYFAYGYRHSKLAKIES