Protein Info for CA265_RS15130 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: 4-hydroxybenzoate octaprenyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01475: putative 4-hydroxybenzoate polyprenyltransferase
  • amino acids 2 to 282 (281 residues), 302.3 bits, E=1.8e-94
• PF01040: UbiA
  • amino acids 17 to 264 (248 residues), 194.5 bits, E=9.8e-62

Best Hits

KEGG orthology group: K03179, 4-hydroxybenzoate octaprenyltransferase [EC: 2.5.1.-] (inferred from 87% identity to phe:Phep_0975)

Predicted SEED Role

"Menaquinone via futalosine polyprenyltransferase (MenA homolog)"

KEGG Metabolic Maps

• Biosynthesis of terpenoids and steroids
• Carotenoid biosynthesis - General
• Methionine metabolism
• Porphyrin and chlorophyll metabolism
• Riboflavin metabolism
• Terpenoid biosynthesis
• Tryptophan metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-

Use Curated BLAST to search for 2.5.1.-

Sequence Analysis Tools

See A0A1X9Z7E8 at UniProt or InterPro

Protein Sequence (285 amino acids)

>CA265_RS15130 4-hydroxybenzoate octaprenyltransferase (Pedobacter sp. GW460-11-11-14-LB5)
MKKYFSLVLFAHSVFALPFAMIGFFLGVTTTENPFSWYKLILVLLCMVFARNSAMAFNRY
LDRNIDAKNPRTKMRDIPAGKVSANEALIFVIANCVLFAITTYFINPLCFYLSPVALFVV
LFYSYTKRFTALCHLVLGLGLALAPIGAYIAVTGHFALVPVLYSLTVLFWVSGFDIIYAL
QDEAFDREEKLHSIPSALGIKNALNVSVLLHILSATCVILPVFFTSFSWVYYVGIVFFCS
MLIYQHLLVKPNDISKVNRAFQTLNGYASVVFAICFLIDAYLRHK