Protein Info for CA265_RS15120 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01209: Ubie_methyltran
  • amino acids 15 to 244 (230 residues), 228.1 bits, E=3.9e-71
• TIGR01934: ubiquinone/menaquinone biosynthesis methyltransferase
  • amino acids 20 to 244 (225 residues), 265.1 bits, E=2e-83
• PF13489: Methyltransf_23
  • amino acids 52 to 226 (175 residues), 49 bits, E=2.3e-16
• PF02353: CMAS
  • amino acids 60 to 163 (104 residues), 27.3 bits, E=9.1e-10
• PF13847: Methyltransf_31
  • amino acids 61 to 166 (106 residues), 70.5 bits, E=5.5e-23
• PF08242: Methyltransf_12
  • amino acids 63 to 159 (97 residues), 59.2 bits, E=2.3e-19
• PF08241: Methyltransf_11
  • amino acids 63 to 162 (100 residues), 73.2 bits, E=8.7e-24
• PF13649: Methyltransf_25
  • amino acids 63 to 158 (96 residues), 75.8 bits, E=1.4e-24

Best Hits

Swiss-Prot: 52% identical to MENG_BACV8: Demethylmenaquinone methyltransferase (menG) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)

KEGG orthology group: K03183, ubiquinone/menaquinone biosynthesis methyltransferase [EC: 2.1.1.- 2.1.1.163] (inferred from 78% identity to phe:Phep_0977)

Predicted SEED Role

"Ubiquinone/menaquinone biosynthesis methyltransferase UbiE (EC 2.1.1.-)" in subsystem Menaquinone Biosynthesis via Futalosine or Menaquinone and Phylloquinone Biosynthesis or Ubiquinone Biosynthesis (EC 2.1.1.-)

MetaCyc Pathways

• menaquinol-4 biosynthesis I (1/1 steps found)
• menaquinol-6 biosynthesis (1/1 steps found)
• menaquinol-8 biosynthesis (1/1 steps found)
• menaquinol-9 biosynthesis (1/1 steps found)
• menaquinol-10 biosynthesis (1/2 steps found)
• menaquinol-11 biosynthesis (1/2 steps found)
• menaquinol-12 biosynthesis (1/2 steps found)
• menaquinol-13 biosynthesis (1/2 steps found)
• menaquinol-7 biosynthesis (1/2 steps found)
• superpathway of menaquinol-8 biosynthesis I (4/10 steps found)
• superpathway of menaquinol-8 biosynthesis II (4/10 steps found)
• superpathway of menaquinol-8 biosynthesis III (3/9 steps found)
• superpathway of menaquinol-10 biosynthesis (3/10 steps found)
• superpathway of menaquinol-11 biosynthesis (3/10 steps found)
• superpathway of menaquinol-12 biosynthesis (3/10 steps found)
• superpathway of menaquinol-13 biosynthesis (3/10 steps found)
• superpathway of menaquinol-6 biosynthesis (3/10 steps found)
• superpathway of menaquinol-7 biosynthesis (3/10 steps found)
• superpathway of menaquinol-9 biosynthesis (3/10 steps found)
• ubiquinol-6 biosynthesis (late decarboxylation) (1/8 steps found)
• ubiquinol-6 biosynthesis from 4-aminobenzoate (yeast) (1/9 steps found)
• superpathway of ubiquinol-6 biosynthesis (late decarboxylation) (1/11 steps found)
• superpathway of chorismate metabolism (35/59 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.163

Sequence Analysis Tools

See A0A1X9ZCU2 at UniProt or InterPro

Protein Sequence (244 amino acids)

>CA265_RS15120 bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase (Pedobacter sp. GW460-11-11-14-LB5)
MMNQNITPYQVEDATKKEQVATMFNNISGTYDFLNHFLSLGIDVLWRKKAIKELVSIHPR
TLLDVATGTGDFAFEAIKKLHPEKVIGVDISEGMLEVAKKKINERSLNEVFTVQVGDSEG
LHFENDTFDAITCAYGVRNFENLEKGLTDMYRVLKPNGKMVILEFSKPKVFPVKQLYSFY
FKQVTPFFGKLFSKDHRAYTYLPESVAAFPDGEDFTNLMEKVGFKSTKQRILTFGISSIY
VGTK