Protein Info for CA265_RS15025 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: GMP synthase (glutamine-hydrolyzing)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00888: GMP synthase (glutamine-hydrolyzing), N-terminal domain
  • amino acids 5 to 190 (186 residues), 208.4 bits, E=6.1e-66
• PF00117: GATase
  • amino acids 7 to 186 (180 residues), 129.6 bits, E=3.6e-41
• PF07722: Peptidase_C26
  • amino acids 70 to 169 (100 residues), 23.2 bits, E=1.6e-08
• TIGR00884: GMP synthase (glutamine-hydrolyzing), C-terminal domain
  • amino acids 199 to 509 (311 residues), 484.2 bits, E=1.7e-149
• PF02540: NAD_synthase
  • amino acids 205 to 281 (77 residues), 30.4 bits, E=6.5e-11
• PF03054: tRNA_Me_trans
  • amino acids 215 to 248 (34 residues), 24 bits, see alignment (E = 8.4e-09)
• PF00958: GMP_synt_C
  • amino acids 418 to 508 (91 residues), 146.1 bits, E=7.8e-47

Best Hits

Swiss-Prot: 75% identical to GUAA_CYTH3: GMP synthase [glutamine-hydrolyzing] (guaA) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K01951, GMP synthase (glutamine-hydrolysing) [EC: 6.3.5.2] (inferred from 84% identity to phe:Phep_0993)

Predicted SEED Role

"GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)" in subsystem Purine conversions or Staphylococcal pathogenicity islands SaPI (EC 6.3.5.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• L-glutamate and L-glutamine biosynthesis (7/7 steps found)
• superpathway of purine nucleotide salvage (12/14 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (3/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Glutamate metabolism
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.5.2

Sequence Analysis Tools

See A0A1X9Z7P5 at UniProt or InterPro

Protein Sequence (509 amino acids)

>CA265_RS15025 GMP synthase (glutamine-hydrolyzing) (Pedobacter sp. GW460-11-11-14-LB5)
MQEKIIIVDFGSQFTQLIARRVRELNIYCEIYPYNNLPEVTPDVKGVIFSGSPYSVRQED
APQIDLSKYHLKYPLLAVCYGAQYIAQHSGGAVQPSSTREYGRANLNFVNQENKLFKGIN
IDSQVWMSHGDTITDIPENFELIASTDSVKVAAYHIKDSDTYAIQFHPEVTHSIDGKILL
ENFLVDICGCSQDWTSAAFVETTIADIKATVGNDKVVLALSGGVDSSVAAVLLHKAIGTN
LHCIFVDNGLLRKNEYESVLEQYKDFGLNIKGVDAKDKFLSQLAGVEDPETKRKIIGRVF
IEVFDEESHLIQDVKWLAQGTIYPDIIESVSVKGPSATIKSHHNVGGLPDFMKLKVVEPL
KTLFKDEVRRVGTTLGLESFILGRHPFPGPGLGIRIIGEVTPEKVAILQDADKIYIDNLK
EAGLYDKVWQAGAIFLPVRSVGVMGDERTYENVIALRAVESLDGMTADWCHLPYPVLAKI
SNEIINKVKGINRVVYDISSKPPATIEWE