Protein Info for CA265_RS14785 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: pyrroloquinoline quinone biosynthesis protein PqqB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF12706: Lactamase_B_2" amino acids 74 to 261 (188 residues), 72.9 bits, see alignment E=1.4e-24

Best Hits

KEGG orthology group: K06136, pyrroloquinoline quinone biosynthesis protein B (inferred from 52% identity to fbc:FB2170_06065)

Predicted SEED Role

"Similar to coenzyme PQQ synthesis protein B" in subsystem Coenzyme PQQ synthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z6M9 at UniProt or InterPro

Protein Sequence (306 amino acids)

>CA265_RS14785 pyrroloquinoline quinone biosynthesis protein PqqB (Pedobacter sp. GW460-11-11-14-LB5)
MRALLLIFILGFAIQAPAQKMPESSFIMVLGVAQDGGYPHMGCQKNCCKMAWKDEKLRRN
VVSLALVDPKTKKWWLFEATPDIKAQLQDFRKKTNETYPYLPEGVFLTHAHIGHYTGLME
FGREVMATRNLNVYVLPKFKSFLTENGPWSQLVSLKNINLIELKANNPLAIAENKITAFT
VPHRDEFSETAGFKIETLVKKYLFIPDIDKWSKWDKSIIEEVKKVDVAMLDATFYTNAEL
GNRPISEVPHPLVTETEDLFDKEDIAIKHKIFFIHFNHTNPLLWDLPTQKQVLKNGFNIA
KQGDVY