Protein Info for CA265_RS14005 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: dihydroorotate dehydrogenase (quinone)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 TIGR01036: dihydroorotate dehydrogenase (fumarate)" amino acids 2 to 341 (340 residues), 427.8 bits, see alignment E=1.3e-132 PF01180: DHO_dh" amino acids 50 to 341 (292 residues), 315.6 bits, see alignment E=1.5e-98

Best Hits

Swiss-Prot: 66% identical to PYRD_FLAJ1: Dihydroorotate dehydrogenase (quinone) (pyrD) from Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101)

KEGG orthology group: K00226, dihydroorotate dehydrogenase (fumarate) [EC: 1.3.98.1] (inferred from 82% identity to phe:Phep_1266)

Predicted SEED Role

"Dihydroorotate dehydrogenase (EC 1.3.3.1)" in subsystem De Novo Pyrimidine Synthesis (EC 1.3.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.3.1 or 1.3.98.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z648 at UniProt or InterPro

Protein Sequence (342 amino acids)

>CA265_RS14005 dihydroorotate dehydrogenase (quinone) (Pedobacter sp. GW460-11-11-14-LB5)
MYRLIKPIFFKFDPENVHYFVVKRLKWFNDKFPLGKTIIRSSFDVHIKGLEREVFGIKFR
NPVGLAAGFDKNGEYVEPLSNLGFGFIEVGTVTPMPQPGNDKPRMFRLPNDEALINRMGF
NNKGVDVMAERLRLLKDKHPDIVVGGNIGKNKATPNEDAVSDYIKCFDRLFDVVDYFVVN
VSSPNTPGLRELQEKEPLKKILNTLQQRNRKNDISRPILLKIAPDLTDAQLDDIIEIVAE
TKIAGIIATNTTISRENLATEKDLTGETGGLSGKPVKERSTEVIRYLSSKSNKAFPIIGV
GGIHSAKDAKEKLDAGASLVQLYTGFIYEGPGLIKSICKELV