Protein Info for CA265_RS13950 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: TspO protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details amino acids 26 to 27 (2 residues), see Phobius details transmembrane" amino acids 25 to 25 (1 residues), see Phobius details amino acids 47 to 69 (23 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 106 to 126 (21 residues), see Phobius details amino acids 133 to 155 (23 residues), see Phobius details PF03073: TspO_MBR" amino acids 12 to 154 (143 residues), 163.7 bits, see alignment E=1.2e-52

Best Hits

KEGG orthology group: K07185, tryptophan-rich sensory protein (inferred from 72% identity to phe:Phep_1272)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z6E5 at UniProt or InterPro

Protein Sequence (157 amino acids)

>CA265_RS13950 TspO protein (Pedobacter sp. GW460-11-11-14-LB5)
MKFKPLAFIVNIAITLGVGALGGWATAQSVKTWYPTLNKPSFNPPNWLFAPVWTTLYVLI
GIAAYLVWIRRDKIVHFPRTVAIYLIQLILNLGWSFIFFYLHEIGFALAEIILLLIVIVV
NASMFYKINKWAGLIFIPYILWVTFASFLTYNIFILN