Protein Info for CA265_RS13895 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: glycosyl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 TIGR01426: glycosyltransferase, MGT family" amino acids 10 to 390 (381 residues), 210.9 bits, see alignment E=1.6e-66 PF00201: UDPGT" amino acids 200 to 366 (167 residues), 62.3 bits, see alignment E=6.2e-21 PF06722: EryCIII-like_C" amino acids 250 to 376 (127 residues), 54.9 bits, see alignment E=1.4e-18 PF04101: Glyco_tran_28_C" amino acids 292 to 371 (80 residues), 41.8 bits, see alignment E=1.8e-14

Best Hits

KEGG orthology group: None (inferred from 64% identity to cpi:Cpin_1446)

Predicted SEED Role

"Zeaxanthin glucosyl transferase" in subsystem Carotenoids

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z6D5 at UniProt or InterPro

Protein Sequence (400 amino acids)

>CA265_RS13895 glycosyl transferase (Pedobacter sp. GW460-11-11-14-LB5)
MAKFVFVVPPLTGHINPTLSMGTALLERGHRVGWITLDESLGEKLPLGGELLLISYDQND
QQKKDSEKYLDIITKKIVYGIDSIKFLYEEVLIPLNRHSYEGIADLLDQFKPDVVITDHQ
MFAGAIAASNTNYPYVTSVTAPAAIKVMDELPKVHEWEVNQIVALQKEFGINATASIACS
DLLTMVFTSRDFFGEMDLPENFQFIGPVFNRRKNVVPFNWDEFNAINKPKILVSIGTTFD
HEHKKAFFAKVIEAFADEDLHVVVVSDPTLFEQWPANFTVQRQVPQLELLPHLDAVVCHG
GHNTVCETLMNGLPMVVIPIAYDQSHVAGRVFRVGAGERLNFNRFKANHLKEAVNKVLQN
DSYKIAAEQIKRSFIEAGGTESAADLLETLSNKTSNVFIS