Protein Info for CA265_RS13580 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: 8-amino-7-oxononanoate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 transmembrane" amino acids 269 to 287 (19 residues), see Phobius details PF00155: Aminotran_1_2" amino acids 44 to 385 (342 residues), 188.3 bits, see alignment E=1.3e-59

Best Hits

Swiss-Prot: 43% identical to BIOF_TREDE: 8-amino-7-oxononanoate synthase (TDE_2194) from Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222)

KEGG orthology group: None (inferred from 88% identity to phe:Phep_2195)

MetaCyc: 42% identical to BioF (Lysinibacillus sphaericus)
8-amino-7-oxononanoate synthase. [EC: 2.3.1.47]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.47

Use Curated BLAST to search for 2.3.1.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z6X4 at UniProt or InterPro

Protein Sequence (401 amino acids)

>CA265_RS13580 8-amino-7-oxononanoate synthase (Pedobacter sp. GW460-11-11-14-LB5)
MRKKLQDRIASFKDAAVIKEKGLYPYFRSIESGQDTEVVINGKKVLMFGSNSYLGLTNHP
KIKEAAKAAIEKYGTGCAGSRFLNGSLDIHLELENRLAEYVGKEAAVLFSTGFQVNLGVI
SCLLDRNDYLLLDEYDHASIIDGSRLAFSRTIKYAHNDMQDLRRKLSRLPEDSAKLIVSD
GIFSMEGDLVNLPEMVDIANEFGANIMMDDAHSLGVIGFNGSGTASHFNLTEDVDLIMGT
FSKSLASLGGFIAGSTETIEYIKHRARSLMFSASMPPSAVASVIAALDIIESEPERIDKL
WANTEYAKKLLLEAGFDIGHSNSPIIPVYIRDNIKTFMITNILQQNGVFVNPVVSPAVPS
DSSLIRFSLMATHTFEQIESAIAKLSAAFKAVNVELVGSQS