Protein Info for CA265_RS13230 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: dephospho-CoA kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01121: CoaE
  • amino acids 4 to 179 (176 residues), 155.7 bits, E=5.4e-50
• TIGR00152: dephospho-CoA kinase
  • amino acids 4 to 181 (178 residues), 136.5 bits, E=4.9e-44

Best Hits

Swiss-Prot: 36% identical to COAE_CHLL7: Dephospho-CoA kinase (coaE) from Chlorobium luteolum (strain DSM 273 / 2530)

KEGG orthology group: K00859, dephospho-CoA kinase [EC: 2.7.1.24] (inferred from 70% identity to phe:Phep_1405)

Predicted SEED Role

"Dephospho-CoA kinase (EC 2.7.1.24)" in subsystem Coenzyme A Biosynthesis (EC 2.7.1.24)

MetaCyc Pathways

• superpathway of coenzyme A biosynthesis I (bacteria) (9/9 steps found)
• superpathway of coenzyme A biosynthesis III (mammals) (5/5 steps found)
• coenzyme A biosynthesis I (bacteria) (4/4 steps found)
• coenzyme A biosynthesis II (eukaryotic) (4/4 steps found)

KEGG Metabolic Maps

• Pantothenate and CoA biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.24

Sequence Analysis Tools

See A0A1X9Z6K8 at UniProt or InterPro

Protein Sequence (205 amino acids)

>CA265_RS13230 dephospho-CoA kinase (Pedobacter sp. GW460-11-11-14-LB5)
MYKVGITGGIGSGKTTACKVFEVLGIPVFYADTVAKAIMCKDVLLVEGVKATFGKESYLD
DGRLNNKHIADIVFNNEEELAKLNALVHPAVFRAFDAWEETIPPNTPYTLKEAALLFESG
SYKMCDTTILVTAPYEIKMKRVMQRDGVTAGQVKARMDKQLSDEEKSKMTDHFIINDEQQ
SIIEQVLALHQEFLKSAKEFKSGKA