Protein Info for CA265_RS13090 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00154: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
  • amino acids 6 to 250 (245 residues), 182.8 bits, E=5.7e-58
• PF00288: GHMP_kinases_N
  • amino acids 83 to 137 (55 residues), 44.1 bits, E=2.2e-15
• PF08544: GHMP_kinases_C
  • amino acids 204 to 255 (52 residues), 38.2 bits, E=1.6e-13

Best Hits

Swiss-Prot: 55% identical to ISPE_BACV8: 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (ispE) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)

KEGG orthology group: K00919, 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC: 2.7.1.148] (inferred from 68% identity to phe:Phep_1424)

Predicted SEED Role

"4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC 2.7.1.148)" in subsystem Isoprenoid Biosynthesis or polyprenyl synthesis (EC 2.7.1.148)

MetaCyc Pathways

• methylerythritol phosphate pathway II (9/9 steps found)
• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (9/12 steps found)
• taxadiene biosynthesis (engineered) (9/13 steps found)
• methylerythritol phosphate pathway I (6/9 steps found)
• isoprene biosynthesis I (6/10 steps found)
• superpathway of ergosterol biosynthesis II (8/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.148

Sequence Analysis Tools

See A0A1X9Z5M5 at UniProt or InterPro

Protein Sequence (267 amino acids)

>CA265_RS13090 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase (Pedobacter sp. GW460-11-11-14-LB5)
MLSFPNAKINLGLNITKKRADGYHNLETVFYPINIKDSVEITDAEETSCKIHGIDIPGDA
NDNLCVKAFQLVKKEYDIPAQQINLLKNIPVGAGLGGGSADCAFLIKLLNEKFSLGMSVD
KMEGYARQLGADCAFFIENKPVYAFNKGDEFEKCEIDLSAWFKVLVKPPVHVSTADAYAQ
VKPQKPLQSLKEIIHLCPTTWKNKVINDFEPSVFAKYPQIRQIKTSLYDAGATFALMSGS
GSSVFAIFDHPVKLPELEENNLVFYNI