Protein Info for CA265_RS13080 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: O-succinylhomoserine sulfhydrylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 49% identical to METZ_PSEAE: O-succinylhomoserine sulfhydrylase (metZ) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K10764, O-succinylhomoserine sulfhydrylase [EC: 2.5.1.-] (inferred from 78% identity to phe:Phep_1425)

MetaCyc: 49% identical to O-succinyl-L-homoserine sulfhydrylase (Pseudomonas aeruginosa PAO1)
Cystathionine gamma-synthase. [EC: 2.5.1.48]

Predicted SEED Role

"O-acetylhomoserine sulfhydrylase (EC 2.5.1.49) / O-succinylhomoserine sulfhydrylase (EC 2.5.1.48)" in subsystem Methionine Biosynthesis (EC 2.5.1.48, EC 2.5.1.49)

MetaCyc Pathways

superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
aspartate superpathway (21/25 steps found)
superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (9/10 steps found)
L-methionine biosynthesis III (4/4 steps found)
superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (14/18 steps found)
L-methionine biosynthesis II (5/6 steps found)
superpathway of L-cysteine biosynthesis (fungi) (5/6 steps found)
L-homocysteine biosynthesis (2/2 steps found)
superpathway of S-adenosyl-L-methionine biosynthesis (7/9 steps found)
superpathway of L-methionine biosynthesis (transsulfuration) (7/9 steps found)
superpathway of L-homoserine and L-methionine biosynthesis (6/8 steps found)
homocysteine and cysteine interconversion (3/4 steps found)
L-methionine biosynthesis I (3/5 steps found)
S-methyl-5-thio-α-D-ribose 1-phosphate degradation II (1/5 steps found)
S-methyl-5-thio-α-D-ribose 1-phosphate degradation III (1/5 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-, 2.5.1.48, 2.5.1.49

Use Curated BLAST to search for 2.5.1.- or 2.5.1.48 or 2.5.1.49

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z6N7 at UniProt or InterPro

Protein Sequence (388 amino acids)

>CA265_RS13080 O-succinylhomoserine sulfhydrylase (Pedobacter sp. GW460-11-11-14-LB5)
MKSENFETIAIRTQTERSLHKEHSSPIYLTSSYKFEDAEEMRALFANEKEGNVYSRYSNP
NTSEFIEKMCLLEGAEDGFATATGMAAIFTTFGAFLKNGDHLVSSRSVFGSTHQLLTNVF
SNWGVTFDYADLDKPQDWEALIKPNTKMIFVETPSNPGIDIIDLEFLGDLAKKHNVLLVV
DNCFATPYLQQPIKFGAHISIHSATKYIDGQGRVLGGVILGTKELIADVIGFARHSGPAL
SPFNAWILSKSLETLAIRMDRHCENALKVAEYLEKHPKIKLVKYPFLPSHPQYDIAKKQM
KQGGGIVTIVVEGGIDAARKFMDGLQMFSISANLADTRSIATHPATSTHSKLTEEQRNEV
GIEQGSIRLSIGLEHINDILADIEQALA