Protein Info for CA265_RS13020 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 PF02527: GidB" amino acids 20 to 188 (169 residues), 127.3 bits, see alignment E=4.7e-41 TIGR00138: 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG" amino acids 26 to 203 (178 residues), 122.7 bits, see alignment E=7.2e-40 PF13847: Methyltransf_31" amino acids 67 to 147 (81 residues), 37.9 bits, see alignment E=1.6e-13

Best Hits

Swiss-Prot: 61% identical to RSMG_CYTH3: Ribosomal RNA small subunit methyltransferase G (rsmG) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K03501, ribosomal RNA small subunit methyltransferase G [EC: 2.1.1.170] (inferred from 78% identity to phe:Phep_1432)

Predicted SEED Role

"rRNA small subunit 7-methylguanosine (m7G) methyltransferase GidB"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.170

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z6C1 at UniProt or InterPro

Protein Sequence (211 amino acids)

>CA265_RS13020 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG (Pedobacter sp. GW460-11-11-14-LB5)
MLDVKPDIVLKYFPDLSDKQIAQFSQLFDLYRYWNAQINVISRKDIEELYERHVLHSLGI
AKVCTFKAGESVLDVGTGGGFPGIPLAILFPETEFYLVDSIGKKIKVVKEVASALGLENL
RADHLRAEQIKEKFNFVVSRAVTRLGEFYPWIQGKFKKDTLNAIPNGILYLKGGDLAEEI
KESKLKAELYPLSAYFEEDFFETKYVVYVPQ