Protein Info for CA265_RS12980 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: ATP-dependent DNA helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 767 PF00580: UvrD-helicase" amino acids 7 to 275 (269 residues), 290.6 bits, see alignment E=6e-90 PF13245: AAA_19" amino acids 11 to 260 (250 residues), 88.9 bits, see alignment E=1.3e-28 PF04851: ResIII" amino acids 13 to 87 (75 residues), 23 bits, see alignment E=2.7e-08 PF13361: UvrD_C" amino acids 280 to 618 (339 residues), 270 bits, see alignment E=1.6e-83 PF13538: UvrD_C_2" amino acids 557 to 614 (58 residues), 35.9 bits, see alignment 2.2e-12 PF21196: PcrA_UvrD_tudor" amino acids 719 to 761 (43 residues), 28.3 bits, see alignment 5.4e-10

Best Hits

Swiss-Prot: 44% identical to PCRA_STAA8: ATP-dependent DNA helicase PcrA (pcrA) from Staphylococcus aureus (strain NCTC 8325)

KEGG orthology group: K03657, DNA helicase II / ATP-dependent DNA helicase PcrA [EC: 3.6.4.12] (inferred from 82% identity to phe:Phep_1437)

Predicted SEED Role

"ATP-dependent DNA helicase UvrD/PcrA" in subsystem DNA repair, bacterial UvrD and related helicases

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.12

Use Curated BLAST to search for 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZCH3 at UniProt or InterPro

Protein Sequence (767 amino acids)

>CA265_RS12980 ATP-dependent DNA helicase (Pedobacter sp. GW460-11-11-14-LB5)
MDYLAGLNPQQRAAVENTKGPVMIVAGAGSGKTRVITFRVAHLIQTGTDPFNILVLTFTN
KASKDMRERISKVVGAEAKNIWMGTFHSVFAKILRVEAEKIGYPSNFTIYDTDDSKSVIR
AILKEMQLDDKLYAANFVFNRISSAKNNLISWGEYQANDQIQAEDIQNKRPLIGQIYETY
AKRCFRAGAMDFDDLLFKTNILLKEHPDVLNKYQQKFRYLMVDEYQDTNFSQYTIVKKLA
AAYQNICVVGDDAQSIYAFRGANIQNILNFERDYPDLKVYKLEQNYRSTQNIVDAASSII
ANNKNQLEKNVFSDNEPGDRIKVSRAFTDNEEGKLVAEAIIQERSTKGYQHNDFAILYRT
NAQSRAMEEGLRKLNIPYRIYGGQSFYQRKEIKDLIAYFRLTFNPKDEEAIKRVINYPKR
GIGDTSIDKIIVAADQHGKTMWDVISNAHEYVDGRLANQLNDFAMMVQSFQAEAKKLDAY
DTALFIAQHAGILKELYTDDSVEGRARYENIQELLNGIKEFAEREDIEEKGLDIFMQDVA
LLTNDDKDGDKNKDTVSLMTIHSAKGLEFKNVFIVGLEENLFPSQMSLTNRTDLEEERRL
FYVAITRAEVKLTLTYATSRYRWGTLTNCEPSRFINEISPKFLELDVKPAKSTSFDGNFD
DDRKTWTSQPRDFFSKPKPAAGATTSAPPVRPKTTSLLAKAHVPTPGFTPSQPHEFQGGM
EVEHEKFGFGKIISLEGTLPDVKATVFFQGLGNKQLLLKFAKLMIVK