Protein Info for CA265_RS12760 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: orotate phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 56% identical to PYRE_BACV8: Orotate phosphoribosyltransferase (pyrE) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)

KEGG orthology group: K00762, orotate phosphoribosyltransferase [EC: 2.4.2.10] (inferred from 88% identity to phe:Phep_1463)

MetaCyc: 52% identical to orotate phosphoribosyltransferase (Bacillus subtilis subtilis 168)
Orotate phosphoribosyltransferase. [EC: 2.4.2.10]

Predicted SEED Role

"Orotate phosphoribosyltransferase (EC 2.4.2.10)" in subsystem De Novo Pyrimidine Synthesis (EC 2.4.2.10)

MetaCyc Pathways

superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (17/18 steps found)
UMP biosynthesis II (6/6 steps found)
superpathway of pyrimidine ribonucleotides de novo biosynthesis (8/9 steps found)
UMP biosynthesis I (5/6 steps found)
UMP biosynthesis III (5/6 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z609 at UniProt or InterPro

Protein Sequence (221 amino acids)

>CA265_RS12760 orotate phosphoribosyltransferase (Pedobacter sp. GW460-11-11-14-LB5)
MYNKSDIELKVAEFLLQIKAIKLQPNNPFTWASGWKSPIYCDNRITLSHPQVRTYIRQKL
AQAIQEEFGSVDVIAGVATAGIPQGVLVAQELGLPFIYVRAKAKEHGTGSLIEGEVVEGQ
RVVVIEDLISTGKSSLQAVEALRAAGLSVAGLAAIFTYGFEKADENFAAAKCRYLTLSNY
GALIDYAAEHSIIAKSDMELLGKWRLNPSEWGQGQVLSSES