Protein Info for CA265_RS12710 in Pedobacter sp. GW460-11-11-14-LB5

Updated annotation (from data): pif1-like DNA repair helicase
Rationale: Specifically important in stress Cisplatin; stress Nalidixic acid sodium salt; stress Lomefloxacin hydrochloride. Contains a pif1-like helicase domain and probably part of the RecD superfamily (see CDD). (SEED_correct)
Original annotation: ATP-dependent endonuclease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 PF13604: AAA_30" amino acids 37 to 216 (180 residues), 79.8 bits, see alignment E=5.6e-26 PF05970: PIF1" amino acids 37 to 204 (168 residues), 35.5 bits, see alignment E=2.1e-12 PF13245: AAA_19" amino acids 39 to 170 (132 residues), 71.9 bits, see alignment E=1.5e-23 PF09848: SLFN-g3_helicase" amino acids 40 to 225 (186 residues), 24.9 bits, see alignment E=3e-09 PF13538: UvrD_C_2" amino acids 410 to 461 (52 residues), 77.4 bits, see alignment 1.5e-25

Best Hits

KEGG orthology group: K01144, exodeoxyribonuclease V [EC: 3.1.11.5] (inferred from 72% identity to phe:Phep_1469)

Predicted SEED Role

"RecD-like DNA helicase Atu2026"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.11.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z5Z3 at UniProt or InterPro

Protein Sequence (477 amino acids)

>CA265_RS12710 pif1-like DNA repair helicase (Pedobacter sp. GW460-11-11-14-LB5)
MIPDKSQLIASAYEHTPTREQLLFCERMSVFLQQDDEYRCFVLKGYAGTGKTTSVAALVK
VLKQFNLRSELLAPTGRAAKVMSQYSYRKALTIHKRIYRKRSAASPEMQFQLAPNLSENT
LFIIDEASMIADEFNETGSSILRDLLEFVYNTKNCFLLFVGDTAQLPPVGSLDSPALNEQ
YLKDKFALTVSSVELKEVVRQGKKSGILANATMLRNQIAKNPENPLPKFLTKSYTDIYNM
PGARLVEGLEYAYRKFGMENTLVVCRSNKSANVYNQQIRARLLYREEELTGGDQIMVVRN
NYFWLPDNEDTAFIANGDMAKVIRVRGEEERYGFRFADATLEFMDFPAAGQISCKVMLDT
LNLESANLPYEQNKKLFDGLNEDYEHIANKRQRMLAIKADPFYNALQIKFAYAVTCHKAQ
GGQWDAVFADQGYLTEEMIDLDFLRWLYTAVTRAKKELYLVNFAPQLFAKTALEDYF