Protein Info for CA265_RS12685 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: multidrug ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 586 transmembrane" amino acids 35 to 56 (22 residues), see Phobius details amino acids 69 to 90 (22 residues), see Phobius details amino acids 151 to 171 (21 residues), see Phobius details amino acids 177 to 197 (21 residues), see Phobius details amino acids 254 to 266 (13 residues), see Phobius details amino acids 269 to 298 (30 residues), see Phobius details PF13748: ABC_membrane_3" amino acids 25 to 188 (164 residues), 34.2 bits, see alignment E=2.7e-12 PF00664: ABC_membrane" amino acids 35 to 305 (271 residues), 182 bits, see alignment E=2.9e-57 PF00005: ABC_tran" amino acids 367 to 519 (153 residues), 101.3 bits, see alignment E=1.1e-32

Best Hits

KEGG orthology group: None (inferred from 74% identity to phe:Phep_2232)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z5E8 at UniProt or InterPro

Protein Sequence (586 amino acids)

>CA265_RS12685 multidrug ABC transporter (Pedobacter sp. GW460-11-11-14-LB5)
MNYNLNQLSNKQEKQSTYKALKSLLKLISAERKNLWLALIAILVNSGLLLLGPLLVGHTV
DAYIRTKQFHGVLIFGGILLVIYMIAMVTGYTQTRLMGGVGQRMLYTLRNAIFNKLQELP
VSFFNQNKAGDLISRVNNDTDKLNQFFSQSLMQFIGSIVTMIGAGIFLLSINLELGAATL
SPAVVIVLFTMALSPWVKGKNAKNLKSVGGMSAEIQESLNNFKVIIAFNRRDYFRKRFDE
ANTENYKTAIGAGLANNIFVPVYGLLSSIAQLITLLFGIYLISTGNFTLGLLVSYIAYTT
NFYNPLRQLAALWTSFQVAMASWDRISQILSLESDLKQIETKETITSDALLEFKNVHFSY
DDSKEILHNINLKFEKGKTYALIGPTGGGKTTTASLISRLYDATKGTVLLNGKDIRSFSA
EERTQKIGFILQEPFLFTGTVKENILYGNSQYKEVSDAQLEKIIEEANLNALLAIFEEGL
NTQITSGSDSISLGQKQLIAFMRAVLRNPELLILDEATANIDTITEQLLGSILNKLSKET
TLVIIAHRLNTIENADEIYFVNEGEVQKAGTLNDALNMLLKGKRVS