Protein Info for CA265_RS12615 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: GTP 3',8-cyclase MoaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 TIGR02666: molybdenum cofactor biosynthesis protein A" amino acids 3 to 326 (324 residues), 353.7 bits, see alignment E=4.4e-110 PF04055: Radical_SAM" amino acids 15 to 173 (159 residues), 124.1 bits, see alignment E=1e-39 PF13353: Fer4_12" amino acids 19 to 119 (101 residues), 25.8 bits, see alignment E=1.8e-09 PF06463: Mob_synth_C" amino acids 179 to 298 (120 residues), 120.2 bits, see alignment E=8.4e-39

Best Hits

Swiss-Prot: 44% identical to MOAA_THEYD: GTP 3',8-cyclase (moaA) from Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)

KEGG orthology group: K03639, molybdenum cofactor biosynthesis protein (inferred from 71% identity to cpi:Cpin_4135)

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z6E0 at UniProt or InterPro

Protein Sequence (326 amino acids)

>CA265_RS12615 GTP 3',8-cyclase MoaA (Pedobacter sp. GW460-11-11-14-LB5)
MIADSFGRIHDYLRISLTDNCNFRCFYCMPEEEYDFTPASRLMQTDEIIKLAAIFVANGV
KKIRLTGGEPLVRKDAAQIIAALGKLPVELVITTNGTRIAEMLPVLKEAGIKTINISLDT
LQPEKFFMITRRDVFHQVRSNIELLLQHKIKVKVNMVVMKGLNDNEIGDFISWTKHNPIQ
IRFIEFMPFSGNKWTSNKMFSLAEILSVVEKDFTVLPVKGEAHDTAKSFMIPGHEGSFAI
ISTMTNPFCDTCNRMRLTADGKLKNCLFSDSETDLLTALRKNEDVLPLIQSAIWSKKKAL
GGQLVSDFEKIDATTIQNRSMITIGG