Protein Info for CA265_RS12375 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 PF12796: Ank_2" amino acids 11 to 99 (89 residues), 64.1 bits, see alignment E=3.6e-21 amino acids 97 to 156 (60 residues), 38.5 bits, see alignment E=3.7e-13 PF13637: Ank_4" amino acids 11 to 57 (47 residues), 37.2 bits, see alignment E=6.8e-13 amino acids 49 to 90 (42 residues), 26.7 bits, see alignment E=1.4e-09 amino acids 78 to 123 (46 residues), 30.8 bits, see alignment E=6.8e-11 amino acids 110 to 154 (45 residues), 29.9 bits, see alignment E=1.4e-10 PF13857: Ank_5" amino acids 23 to 74 (52 residues), 45.8 bits, see alignment E=1.5e-15 amino acids 89 to 143 (55 residues), 37 bits, see alignment E=8.3e-13 PF00023: Ank" amino acids 37 to 67 (31 residues), 31.3 bits, see alignment 4.3e-11 amino acids 70 to 99 (30 residues), 18.4 bits, see alignment 5.3e-07 amino acids 102 to 130 (29 residues), 25.6 bits, see alignment 2.8e-09 PF13606: Ank_3" amino acids 37 to 65 (29 residues), 22.3 bits, see alignment 3.1e-08 amino acids 102 to 129 (28 residues), 24.1 bits, see alignment 8.1e-09

Best Hits

KEGG orthology group: K06867, (no description) (inferred from 67% identity to dfe:Dfer_5572)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z594 at UniProt or InterPro

Protein Sequence (168 amino acids)

>CA265_RS12375 hypothetical protein (Pedobacter sp. GW460-11-11-14-LB5)
MENINELIIPAARQGEVEVLRELIRRGVDLNHRDEKGYTPLIIACYNKQLEAAKLLIDAG
ADLNAADTGGNTALMGVAFKGYIDIASLLIESGALLNLQHGNGGTALMFAAMFGRNDVLQ
LLLNHGADRYMLDVRGQSALDFAALQGNEMGIQLLESQNGATHLSKAP