Protein Info for CA265_RS12270 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: RNA polymerase subunit sigma

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 6 to 163 (158 residues), 69.1 bits, see alignment E=1.7e-23 PF04542: Sigma70_r2" amino acids 13 to 73 (61 residues), 47.7 bits, see alignment E=1.7e-16 PF08281: Sigma70_r4_2" amino acids 109 to 156 (48 residues), 48 bits, see alignment E=1.2e-16

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 57% identity to phe:Phep_3701)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z5H6 at UniProt or InterPro

Protein Sequence (168 amino acids)

>CA265_RS12270 RNA polymerase subunit sigma (Pedobacter sp. GW460-11-11-14-LB5)
MTQKEFSETISFHASSLRSHALNFTRDPEDANDLLQETLLKATRFVSKFEDGTNIKGWLF
VIMKNTFINNYKKSLKNRDRTVQEEEITSANLYYSATTNGSVGSFAMQDINLALSMLPEK
YAAPFIRYFEGYKYHEIADEMQLPLGTVKTYIHEARILLKKYLKQYQS