Protein Info for CA265_RS12250 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: enolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 transmembrane" amino acids 319 to 341 (23 residues), see Phobius details PF02746: MR_MLE_N" amino acids 33 to 143 (111 residues), 67.1 bits, see alignment E=1.7e-22 PF13378: MR_MLE_C" amino acids 167 to 379 (213 residues), 212.7 bits, see alignment E=5.4e-67

Best Hits

KEGG orthology group: None (inferred from 79% identity to hhy:Halhy_2207)

Predicted SEED Role

"L-alanine-DL-glutamate epimerase and related enzymes of enolase superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z560 at UniProt or InterPro

Protein Sequence (388 amino acids)

>CA265_RS12250 enolase (Pedobacter sp. GW460-11-11-14-LB5)
MKITNVEAFWLRCPIPEAKQHVSDYGLLTSFDMTLVVITTDSGLQGFGEAKAAVGSCGIC
ASIVNCIENELKPMLLGKSVKNITRLWEEMYNGTRDHYALSRGRKFPILGRRGLTISAMS
GIDTALWDLKGKMLNVPVADLLGGACRTKMPAYASGGWADEQNIGEQLMGYVNKGFKGVK
MRVGVMDDTVQKSINRVKAARAALGPDIKLMVDAHGTFSVPEAKQFCRGVEDCNVYWFEE
PISPDNRKGTAEVRAATDIPIAAGESEFTSFDIHDLLQIRAIDVVQPDAAIIGGISEAMR
VSHLASVHQVELAPHCWGSAFSFMAGLTVAFASASATIIEFSLGGNPMMYDLVNEQIAVV
NGEISAPTAPGLGLTPNWDFVKQFKQSV