Protein Info for CA265_RS12135 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 transmembrane" amino acids 68 to 88 (21 residues), see Phobius details PF04773: FecR" amino acids 170 to 265 (96 residues), 72.9 bits, see alignment E=2.4e-24 PF16344: FecR_C" amino acids 307 to 374 (68 residues), 78.6 bits, see alignment E=2.8e-26

Best Hits

KEGG orthology group: None (inferred from 45% identity to phe:Phep_0949)

Predicted SEED Role

"putative anti-sigma factor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z593 at UniProt or InterPro

Protein Sequence (376 amino acids)

>CA265_RS12135 hypothetical protein (Pedobacter sp. GW460-11-11-14-LB5)
MKSEVEALLEKYLEGKASQEECAIVESWYLHLADEKDMPSAKQIEAARKKVWNNLSANRK
THWKDKFWLGRVAAILIVVCFGSYFYFLTPKKYPKHANGGSAMHEIRPGTNTAVLTLADG
KKIILADVGTGQIAMQSGIKVTKTAKGELIYEFTHVINDNPAIGEASFNTIQTPPGGQYQ
LQLPDGSKVWLNAASSLKFPVRFGDRERKVELVGEGYFEVAKDKKRMFKVSANKLEINVF
GTHFNISAYPEDNKTKTTLLEGSVKVIALDYHSLFLKPGQQAAVKGSAIEVKTVDAEAAI
GWKKGLFVFDNERIETIMKRISRWYNVDVVYTGRTSKERFMGTISRDEDINKVLDMLELT
DLVHFKVEGRRIIVMP