Protein Info for CA265_RS11630 in Pedobacter sp. GW460-11-11-14-LB5

Updated annotation (from data): prephenate and/or arogenate dehydratase (EC 4.2.1.51)
Rationale: Important for fitness in defined media unless phenylalanine is provided. 34% identical to prephenate/arogenate dehydratase from Oryza sativa (Q6Z3Y3). It is uncertain whether dehydration occurs first or transamination (to arogenate) occurs first.
Original annotation: prephenate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K04518, prephenate dehydratase [EC: 4.2.1.51] (inferred from 78% identity to phe:Phep_1513)

Predicted SEED Role

"Prephenate dehydratase (EC 4.2.1.51)" in subsystem Chorismate Synthesis or Phenylalanine and Tyrosine Branches from Chorismate (EC 4.2.1.51)

MetaCyc Pathways

superpathway of aromatic amino acid biosynthesis (18/18 steps found)
superpathway of L-phenylalanine biosynthesis (10/10 steps found)
L-phenylalanine biosynthesis I (3/3 steps found)
L-phenylalanine biosynthesis III (cytosolic, plants) (1/2 steps found)
superpathway of chorismate metabolism (35/59 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.51

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z4Y0 at UniProt or InterPro

Protein Sequence (277 amino acids)

>CA265_RS11630 prephenate and/or arogenate dehydratase (EC 4.2.1.51) (Pedobacter sp. GW460-11-11-14-LB5)
METTKRVAIQGIKASFHEEAAYKFFGKDIETVECNSFKETCDKLEKNDADFVVMAIENSI
AGSLLPNYTLIRDFGFSVVGEVYLPIQLHLMALPGVKFEDIKVVTSHPIAIRQCIDFFYD
YPHIKIVESNDTAACAKRIQEEQLTDTMAIANSLAAELYSLNILERRVESNKKNYTRFLI
LKKDKTDEGKKINKASICFQVGHKAGSLATVLNIFAEQDVSLTKIQSMPVLGKRNEYYFY
VDLEWPSTEKYDKAIRKALKYTSNFNILGEYQKNDKV