Protein Info for CA265_RS10865 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: general stress protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 PF16242: Pyrid_ox_like" amino acids 26 to 174 (149 residues), 156.7 bits, see alignment E=3.1e-50 PF01243: Putative_PNPOx" amino acids 28 to 112 (85 residues), 28.2 bits, see alignment E=1.7e-10

Best Hits

KEGG orthology group: None (inferred from 60% identity to shg:Sph21_3764)

Predicted SEED Role

"Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.4.3.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.3.5

Use Curated BLAST to search for 1.4.3.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z4H3 at UniProt or InterPro

Protein Sequence (184 amino acids)

>CA265_RS10865 general stress protein (Pedobacter sp. GW460-11-11-14-LB5)
MATSQEGSTNNTQEENNIKDLDGKAAIEKLRTLAEKAESCFFCTNIKTGIPLSVRPMAIQ
QVDDEGNIWFMSMKDSHKNEEISTDPFTHLLFQAGAHSGFVNIYGISEISRDQAKIDELW
SPFIKTWFQGGKDDPDITLIKVIPSEGYYWDTKHGTAVAFLKMAASVITGKTMDDSVEGT
LEVD