Protein Info for CA265_RS10665 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: Rossman fold protein, TIGR00730 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 TIGR00730: TIGR00730 family protein" amino acids 6 to 178 (173 residues), 173.2 bits, see alignment E=2.2e-55 PF18306: LDcluster4" amino acids 20 to 137 (118 residues), 45.7 bits, see alignment E=5.3e-16 PF03641: Lysine_decarbox" amino acids 49 to 179 (131 residues), 144.1 bits, see alignment E=3e-46

Best Hits

Swiss-Prot: 44% identical to LOGH_PSEAE: Putative cytokinin riboside 5'-monophosphate phosphoribohydrolase (PA4923) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K06966, (no description) (inferred from 54% identity to har:HEAR1231)

Predicted SEED Role

"Lysine decarboxylase family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z4E8 at UniProt or InterPro

Protein Sequence (197 amino acids)

>CA265_RS10665 Rossman fold protein, TIGR00730 family (Pedobacter sp. GW460-11-11-14-LB5)
MNKLNSVCVYCGSNFNGDITLRKAIKQLAETLVKQQIRLIYGGGSVGVMGVLANDVLELG
GLVTGVIPQFLMDKEVGHQGLTEMVVTENMHQRKQKMADLSDGFVILPGGFGTLEEFFEV
LTWLQLGLHNKPIGVLNVSGFYDPLFAQMDMMVQSKFLKPANRDLVFNEADAEILIHKMD
GFSASPDEVWFRERNLS