Protein Info for CA265_RS10615 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: diacylglycerol kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 123 transmembrane" amino acids 33 to 51 (19 residues), see Phobius details amino acids 56 to 76 (21 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details PF01219: DAGK_prokar" amino acids 16 to 117 (102 residues), 113.9 bits, see alignment E=1.4e-37

Best Hits

Swiss-Prot: 36% identical to UDPK_STRMU: Undecaprenol kinase (dgkA) from Streptococcus mutans serotype c (strain ATCC 700610 / UA159)

KEGG orthology group: K00901, diacylglycerol kinase [EC: 2.7.1.107] (inferred from 54% identity to fte:Fluta_2376)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.107

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z4F5 at UniProt or InterPro

Protein Sequence (123 amino acids)

>CA265_RS10615 diacylglycerol kinase (Pedobacter sp. GW460-11-11-14-LB5)
MSNQKFSIIDRIKSFKYAFNGLKLFFVKDHNGRVHLFAAIIAIGLSFYLKISDLEWIAIL
SVISAVIVAEILNAAIEKLADVVSPDYHPKIKVVKDLAAAAVLVAAFLAVAVGFIVFFPK
LFL