Protein Info for CA265_RS10530 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: ribonuclease R

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 710 TIGR02063: ribonuclease R" amino acids 14 to 708 (695 residues), 760.1 bits, see alignment E=2.3e-232 TIGR00358: VacB and RNase II family 3'-5' exoribonucleases" amino acids 71 to 708 (638 residues), 547 bits, see alignment E=6e-168 PF08206: OB_RNB" amino acids 81 to 139 (59 residues), 46 bits, see alignment 8.6e-16 amino acids 153 to 204 (52 residues), 24.3 bits, see alignment 5.2e-09 PF17876: CSD2" amino acids 159 to 233 (75 residues), 84 bits, see alignment E=1.6e-27 PF17849: OB_Dis3" amino acids 171 to 227 (57 residues), 42.9 bits, see alignment 1e-14 PF00773: RNB" amino acids 255 to 582 (328 residues), 376 bits, see alignment E=4.3e-116 PF00575: S1" amino acids 625 to 706 (82 residues), 45.1 bits, see alignment E=2.8e-15

Best Hits

KEGG orthology group: K12573, ribonuclease R [EC: 3.1.-.-] (inferred from 79% identity to phe:Phep_1629)

Predicted SEED Role

"3'-to-5' exoribonuclease RNase R" in subsystem RNA processing and degradation, bacterial

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z4R7 at UniProt or InterPro

Protein Sequence (710 amino acids)

>CA265_RS10530 ribonuclease R (Pedobacter sp. GW460-11-11-14-LB5)
MAKKKSANIKLVLNQLVSDVFEKNNNQLLNYKQVSAKLNLNDQESRETILEILKEGKSAG
IFLEPEKGKFKLKELQNFIIGTVDMTADGSAYIVPEDEFEKDIFVAPRKLKNALHGDTVK
AYVFAKKSGRKNDGEVVEIIKRAKSDFTGVIKISDRFAFVIADDKKMMHDIFVPLADTHE
AKNGQRVLVTLSDWPESAKNPIGIVKHVLGNQGENNTEMNAILAQYGFPLEFPPQVEREA
NAIPEEIPAAEIAKRKDFRNVLTFTIDPADAKDFDDAISYQKLPNGNHEIGVHIADVSHY
VIQGTELDKEAYSRATSVYLVDRVIPMLPERLSNGVCSLRPHEDKLCFAAVFELDEQANI
QSEWYGRTVIHSDRRFSYEEAQEVIENKEGDYAKEILKLNELAYILRDRKFKNGAISFES
TEVKFKLDEAGKPIGVYVKERKDAHKLIEDYMLLANRKVAEFIAKKTKGKDKLTFVYRVH
DSPNMETLNTFATFASRFGYKINTKSDKEIAKSLNNLMNDVEGKKEQNILTSLAIRSMAK
AIYSTKKTSHYGLAFEYYTHFTSPIRRYPDVMAHRLLQTYLDGGKSADMEFYEVACVHSS
AMEKRAADAERASIKYKQAEYLENNIGTAYKGIISGVTEWGMYVEIEENKCEGMIRLRDI
SDDFYVLDEKNYCIVGQRKKKKYQLGDEVMIRVKKVDLSKRQIDFTLIPD