Protein Info for CA265_RS10460 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 39 to 62 (24 residues), see Phobius details amino acids 74 to 94 (21 residues), see Phobius details amino acids 100 to 118 (19 residues), see Phobius details amino acids 136 to 153 (18 residues), see Phobius details amino acids 159 to 179 (21 residues), see Phobius details amino acids 189 to 214 (26 residues), see Phobius details amino acids 231 to 251 (21 residues), see Phobius details PF01925: TauE" amino acids 8 to 246 (239 residues), 153.5 bits, see alignment E=3.8e-49

Best Hits

KEGG orthology group: None (inferred from 53% identity to fjo:Fjoh_2925)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z4D1 at UniProt or InterPro

Protein Sequence (257 amino acids)

>CA265_RS10460 hypothetical protein (Pedobacter sp. GW460-11-11-14-LB5)
MVNELILLCLVAFAAGFIDAIVGGGGLLQTPAILLILPHYPVATLLGTTKIPSMAGTTLA
AFKYSKQVSFNYKVLAACVLTAFLAALMGAFLVSRIDNSVIKPVILVVLILVALYTYFNK
QFGIHQEKDHSLKQQVLMAALFGILIGFYDGLIGPGTGSFLILVFIAVLGFDFIGASAHA
KIVNMATNLAAIIYFSSTGHILFQYAIPMALFNLTGAFFGTKLALLKGNKFVRVFFLIVV
FGTILRFAYDILKVYVV