Protein Info for CA265_RS10335 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 558 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00089: Trypsin" amino acids 58 to 217 (160 residues), 22 bits, see alignment E=3.3e-08 PF13365: Trypsin_2" amino acids 64 to 200 (137 residues), 77.3 bits, see alignment E=5.3e-25 PF00595: PDZ" amino acids 395 to 445 (51 residues), 28.4 bits, see alignment 4.3e-10 PF13180: PDZ_2" amino acids 397 to 462 (66 residues), 30.9 bits, see alignment E=6.9e-11 PF17820: PDZ_6" amino acids 415 to 446 (32 residues), 30.3 bits, see alignment (E = 7.7e-11)

Best Hits

Predicted SEED Role

"HtrA protease/chaperone protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z532 at UniProt or InterPro

Protein Sequence (558 amino acids)

>CA265_RS10335 hypothetical protein (Pedobacter sp. GW460-11-11-14-LB5)
MNNYIKGIAITIGVLLSLNAVAQKKQLVKFQKTIAEAVKKAYPASVRMWGFDVQQNQRTS
AQFSGVVVSADGYILTAAHTILPGKNYKVFFPDGRECIALALGKIENKDTPGIPDVGLMK
ITDKGTWPFAEMGYSASLLKNEPCISISYPESLNQTLPTLRLGTVAEVKNEYGFIRSTCK
MEPGDSGGPLFDYYGRVIGLHSAIDVSEEMNFEIPVDLYRRYWTALNSETLYTAFPEKVD
EVKTDPLLRVLQKESKQKAFHPDFDIPGFKNSCFFIKSSLKGKNQEIIATLFNVKMPGGT
KKQFLLSKHTMVGENARLDNNGSAVPLQLMAKDQENDLVLFQVDQKLTGGIDLDLNSSDT
LKIEMGRFLYTVEPGGKVMHSVLGSSLFNLPKINNQPYLGAMVVYNSSPVQFSLIKAGSP
AEKAGLKVGDELISMNGMPMKKASEFAPELLKYWADDEVTFEWTNPVGKMKKTFKLEGRG
QSVSNHPAEKFEGGKSARRDGFNAVFTHDAAIKPNACGSPVFDWQGNFYGINIARFSRTT
TVVVPKKSMISFLLKTVQ