Protein Info for CA265_RS10130 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: Na+/H+ antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 538 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 28 to 49 (22 residues), see Phobius details amino acids 55 to 72 (18 residues), see Phobius details amino acids 83 to 106 (24 residues), see Phobius details amino acids 112 to 134 (23 residues), see Phobius details amino acids 156 to 176 (21 residues), see Phobius details amino acids 183 to 204 (22 residues), see Phobius details amino acids 212 to 229 (18 residues), see Phobius details amino acids 233 to 250 (18 residues), see Phobius details amino acids 270 to 291 (22 residues), see Phobius details amino acids 303 to 327 (25 residues), see Phobius details amino acids 348 to 370 (23 residues), see Phobius details amino acids 382 to 405 (24 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 10 to 408 (399 residues), 196.7 bits, see alignment E=2.8e-62 TIGR00831: Na+/H+ antiporter" amino acids 11 to 529 (519 residues), 360.5 bits, see alignment E=7.1e-112

Best Hits

KEGG orthology group: K03316, monovalent cation:H+ antiporter, CPA1 family (inferred from 62% identity to dfe:Dfer_0325)

Predicted SEED Role

"Na+/H+ antiporter" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZDB5 at UniProt or InterPro

Protein Sequence (538 amino acids)

>CA265_RS10130 Na+/H+ antiporter (Pedobacter sp. GW460-11-11-14-LB5)
MHQLIIQYAFLLAIILFVVMLAQKIRVAYPIVLVIAGLALSFLPILRNIEIEPELIFVIF
LPPLLYEAAWNTSWKDFWKWRRVISSFAFPIVIFTSSIVALISQSLIPGFTWALGFLLGG
IISPPDAVSASAILKNVKVPKRLTTILEGESLLNDASSLVVFRFALAAVMTGSFVFSKAA
GNFVLVIVMGILIGIAVALVFYALHRWLPTTTNIDIILTFLTPYVMYITAEEFEFSGVLA
VVSGGLFLSARRDRILTHRSRLQGINVWEAVAFVLNGFVFLLIGLEFPVIIHGLGNDGLL
PAIRYSAIICTVLIVTRLASTYGALYFTRFISRYITTADPNPSWKAPLLFGWAGMRGVVS
LAAALSIPVALKSGEAFPQRNLILFITFSVILVTLVLQGLTLPALIKWVDMPDPDYTVSF
EQQKQMVRKKLSMLSLKILDEKYHDALLHNDMIRSIKIRIEAEMELLRDWEKEENISRAE
GFYHDYRVALEDIMAEQRILLKGLNKKEQINDELIKEQLELLDLEEEKLRRHFSQRDA