Protein Info for CA265_RS09980 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: NAD(P)-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 PF00106: adh_short" amino acids 41 to 232 (192 residues), 169.3 bits, see alignment E=1.1e-53 PF08659: KR" amino acids 43 to 218 (176 residues), 44 bits, see alignment E=3.6e-15 PF13561: adh_short_C2" amino acids 49 to 279 (231 residues), 216.2 bits, see alignment E=7.6e-68

Best Hits

Swiss-Prot: 59% identical to YHDF_BACSU: Uncharacterized oxidoreductase YhdF (yhdF) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 76% identity to shg:Sph21_2145)

MetaCyc: 46% identical to NADP+-dependent aldehyde reductase (Escherichia coli K-12 substr. MG1655)
1.1.1.-

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z4B3 at UniProt or InterPro

Protein Sequence (284 amino acids)

>CA265_RS09980 NAD(P)-dependent oxidoreductase (Pedobacter sp. GW460-11-11-14-LB5)
MMKSQKTPAKQHQQPGIEAKMNPRPEVIKENYRGAGKLNNQVALITGGDSGIGRSVAVHF
AREGADVAIVYLNEDIDAKETQKMVEAEGKKCLLIKGDVKKPAFCKKAVENTIKQFGKIN
ILVNNAGMQVPQKDPKKIDNKQLEDTFRTNIFGYFYFAHEVLEHFKPGDSIINTTSVTAY
RSSPNLIDYSSTKGAITSFTRSLATNLATKGIRVNAVAPGPVWTPLIVSTFDEKKIKSFG
SQTAMERAGQPSEIAPAYVFLASDDASFITGQVIHVNGGEVVNG