Protein Info for CA265_RS09960 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: FMN-dependent NADH-azoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 PF02525: Flavodoxin_2" amino acids 1 to 195 (195 residues), 176.2 bits, see alignment E=7e-56 PF03358: FMN_red" amino acids 1 to 172 (172 residues), 56.7 bits, see alignment E=2.3e-19

Best Hits

Swiss-Prot: 45% identical to AZOR_RHILO: FMN-dependent NADH-azoreductase (azoR) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

KEGG orthology group: K01118, FMN-dependent NADH-azoreductase [EC: 1.7.-.-] (inferred from 60% identity to shg:Sph21_2625)

Predicted SEED Role

"FMN-dependent NADH-azoreductase"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.7.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z425 at UniProt or InterPro

Protein Sequence (198 amino acids)

>CA265_RS09960 FMN-dependent NADH-azoreductase (Pedobacter sp. GW460-11-11-14-LB5)
MKILHLISSPRGEASFSIKLGNAIVEKLQAANPGSSLITHNLTDTPFPHLEEVHINSFFT
PVENHTSEFAEAIKHSNEAIAELKNADAIVIGAPLYNFGIPSTLKSWIDHIARAGQTFSY
SEKGPEGLVKNKKVYLAISSGGVYSEGPMKAYDFTESYLRSVLGFMGMVDITAIRAEGLS
MPNLKDEALDKAVESIVL