Protein Info for CA265_RS09920 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: protein tyrosine phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01451: LMWPc
  • amino acids 4 to 132 (129 residues), 73.6 bits, E=1.1e-24

Best Hits

Swiss-Prot: 51% identical to ARSC_GEOTN: Arsenate reductase (arsC) from Geobacillus thermodenitrificans (strain NG80-2)

KEGG orthology group: K03741, arsenate reductase [EC: 1.20.4.1] (inferred from 75% identity to shg:Sph21_0232)

Predicted SEED Role

"Arsenate reductase (EC 1.20.4.1)" in subsystem Anaerobic respiratory reductases or Arsenic resistance (EC 1.20.4.1)

MetaCyc Pathways

• arsenate detoxification III (1/2 steps found)
• arsenic detoxification (bacteria) (1/4 steps found)
• arsenate detoxification I (2/6 steps found)
• arsenic detoxification (plants) (2/6 steps found)
• arsenic detoxification (yeast) (3/12 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.20.4.1

Use Curated BLAST to search for 1.20.4.1

Sequence Analysis Tools

See A0A1X9Z3Y6 at UniProt or InterPro

Protein Sequence (139 amino acids)

>CA265_RS09920 protein tyrosine phosphatase (Pedobacter sp. GW460-11-11-14-LB5)
MKNVLVLCTGNSCRSQLAEGYLKYFAQDKAKIYSAGIEVHGVNPRAIKVMAEDGIDISGQ
TSNNMEEYFDIPFDYIITVCDHAKESCPHFPTQAIKLHHNFPDPAKAVGTEEEIMAQFRN
TRDLVKAYMKDFVEKNFKG