Protein Info for CA265_RS09865 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: FAD-binding molybdopterin dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 PF00941: FAD_binding_5" amino acids 3 to 218 (216 residues), 156 bits, see alignment E=8.4e-50 PF03450: CO_deh_flav_C" amino acids 227 to 300 (74 residues), 58.2 bits, see alignment E=7.9e-20

Best Hits

KEGG orthology group: K11178, xanthine dehydrogenase YagS FAD-binding subunit [EC: 1.17.1.4] (inferred from 64% identity to sli:Slin_0112)

Predicted SEED Role

"Periplasmic aromatic aldehyde oxidoreductase, FAD binding subunit YagS" in subsystem Purine Utilization

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.17.1.4

Use Curated BLAST to search for 1.17.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z3X6 at UniProt or InterPro

Protein Sequence (327 amino acids)

>CA265_RS09865 FAD-binding molybdopterin dehydrogenase (Pedobacter sp. GW460-11-11-14-LB5)
MINFQYLRTTTAKSAIALLVKDKNAKFLAGGTNLIDLMKRGVTAPEKLIDINHVPLKQIE
QIGNKIHIGALASNTAVADHALIKEKLPLLSWALQAGASAQLRNVATVGGNMMQRTRCGY
FYDTEMPCNKRQPGTGCGAMEGFNRMHAIFGTSEKCIAVHPSDMCVALVALDAEVILANA
KGERKMPFKEFHRLVGDTPQLDNNLKVDEMIIRLEIPVNNLAKNYHYLKVRDRASYAFAL
VSVAAAFEISNNKITDVRLAMGGVAHKPWRLTASENFLKGKEATLSNFEQAAQLAMKDAK
GFGGNDFKLKLAPNTIIEALNLAKSKA