Protein Info for CA265_RS09650 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: diaminopimelate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01048: diaminopimelate decarboxylase
  • amino acids 12 to 385 (374 residues), 397.6 bits, E=2.5e-123
• PF00278: Orn_DAP_Arg_deC
  • amino acids 17 to 366 (350 residues), 89.1 bits, E=2.9e-29
• PF01168: Ala_racemase_N
  • amino acids 25 to 226 (202 residues), 26.8 bits, E=6e-10
• PF02784: Orn_Arg_deC_N
  • amino acids 32 to 270 (239 residues), 177.6 bits, E=4.5e-56

Best Hits

Swiss-Prot: 55% identical to DCDA_BACTN: Diaminopimelate decarboxylase (lysA) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K01586, diaminopimelate decarboxylase [EC: 4.1.1.20] (inferred from 81% identity to phe:Phep_2332)

Predicted SEED Role

"Diaminopimelate decarboxylase (EC 4.1.1.20)" in subsystem Lysine Biosynthesis DAP Pathway (EC 4.1.1.20)

MetaCyc Pathways

• aspartate superpathway (21/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• L-lysine biosynthesis II (8/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (14/18 steps found)
• L-lysine biosynthesis III (6/7 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• L-lysine biosynthesis I (7/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.20

Sequence Analysis Tools

See A0A1X9Z460 at UniProt or InterPro

Protein Sequence (390 amino acids)

>CA265_RS09650 diaminopimelate decarboxylase (Pedobacter sp. GW460-11-11-14-LB5)
MFADKDISKFNNIETPFYYYDTDLLQKTLRTCADAAAPYQFHIHYALKANFNSVLLNQIK
EIGFGADCVSAGEVRRAVEVGFDHKKIVFAGVGKSDKEINEALDLDIFCFNVESIQELEV
LNELAGKKGKTAQVAIRINPNVDAHTHHNITTGLDENKFGINSWDLPECADTLKASPNLK
FIGIHFHIGSQITNLDVYKNLCVRVNEFAAWFEDKGFNLQVLNVGGGLGIDYHNPDHQIP
DFKSYFKIFSEFLTVKPGQEVHFELGRALVGQSASLITRVLYIKNGKKKNFVVLDAGMTE
LMRPALYQAYHKIENLSRKSEVGSPESTALKYDIVGPICESTDCFGKEVEQPESFRGDIF
AIRSAGAYGEVMASKYNLRDAIRSVYSSEI