Protein Info for CA265_RS09610 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: heat-shock protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 144 PF00011: HSP20" amino acids 43 to 143 (101 residues), 74.7 bits, see alignment E=5.7e-25 PF17886: ArsA_HSP20" amino acids 48 to 127 (80 residues), 25.5 bits, see alignment E=7.6e-10

Best Hits

KEGG orthology group: None (inferred from 72% identity to phe:Phep_2326)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z4A7 at UniProt or InterPro

Protein Sequence (144 amino acids)

>CA265_RS09610 heat-shock protein (Pedobacter sp. GW460-11-11-14-LB5)
MTLVNFNNRTRNTAPYFNNVFDSLFSDAVSKNKMVDKSPNVNIYENETAYVIELAAPGLK
KEDFQINLKKDTLSVWAEVKKEEIQVAKDFTRKEFDYSSFARSFNLPDSADGDNITAEYK
DGILSINISKKDDAKLQHKEIVVS