Protein Info for CA265_RS09525 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: protein-(glutamine-N5) methyltransferase, release factor-specific

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 TIGR03534: protein-(glutamine-N5) methyltransferase, release factor-specific" amino acids 31 to 282 (252 residues), 241.9 bits, see alignment E=7.6e-76 TIGR00536: methyltransferase, HemK family" amino acids 57 to 283 (227 residues), 184.5 bits, see alignment E=2.2e-58 PF02527: GidB" amino acids 89 to 191 (103 residues), 31.5 bits, see alignment E=4.9e-11 PF05175: MTS" amino acids 117 to 203 (87 residues), 62.9 bits, see alignment E=1.3e-20 PF13847: Methyltransf_31" amino acids 120 to 246 (127 residues), 49.8 bits, see alignment E=1.5e-16 PF06325: PrmA" amino acids 120 to 192 (73 residues), 33.4 bits, see alignment E=1.5e-11 PF13649: Methyltransf_25" amino acids 123 to 192 (70 residues), 47.1 bits, see alignment E=1.4e-15 PF08242: Methyltransf_12" amino acids 124 to 192 (69 residues), 32.5 bits, see alignment E=5.3e-11 PF08241: Methyltransf_11" amino acids 124 to 192 (69 residues), 31.5 bits, see alignment E=1.1e-10 PF01170: UPF0020" amino acids 142 to 205 (64 residues), 32.4 bits, see alignment E=3.4e-11

Best Hits

Swiss-Prot: 53% identical to PRMC_FLAPJ: Release factor glutamine methyltransferase (prmC) from Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511)

KEGG orthology group: K02493, methyltransferase [EC: 2.1.1.-] (inferred from 50% identity to cly:Celly_3297)

Predicted SEED Role

"Protein-N(5)-glutamine methyltransferase PrmC, methylates polypeptide chain release factors RF1 and RF2"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z3Q0 at UniProt or InterPro

Protein Sequence (295 amino acids)

>CA265_RS09525 protein-(glutamine-N5) methyltransferase, release factor-specific (Pedobacter sp. GW460-11-11-14-LB5)
MKIGELAEHYELELEPLYDNNEAKALFSIAAEKVLALSSGKLIMQKNIEVSFINMQKLLS
ILNDLQIGKPIQHILAEAHFYGAVFSVNEHVLIPRPETEELVDWIISDNRSQFSVNSNHK
ISILDIGTGSGCIPITLKKHLPKAEVSALDVSAHAITVAKHNAERLGEQIRFIEADILTF
RSEEKFDIIVSNPPYIRDLEKADMHHNVLVYEPHLALFVRDENPLIFYKAIAEFAKTNLK
PNGQLYFEINEYLGKETVEMLKDKGFVNIELRQDMQGKDRMVSAGSPMSEVGSQK