Protein Info for CA265_RS09455 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: FUSC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 719 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 41 to 58 (18 residues), see Phobius details amino acids 70 to 87 (18 residues), see Phobius details amino acids 93 to 112 (20 residues), see Phobius details amino acids 117 to 134 (18 residues), see Phobius details amino acids 140 to 162 (23 residues), see Phobius details amino acids 405 to 435 (31 residues), see Phobius details amino acids 447 to 467 (21 residues), see Phobius details amino acids 472 to 488 (17 residues), see Phobius details amino acids 494 to 517 (24 residues), see Phobius details amino acids 522 to 543 (22 residues), see Phobius details amino acids 618 to 632 (15 residues), see Phobius details PF12805: FUSC-like" amino acids 71 to 348 (278 residues), 170.1 bits, see alignment E=8.9e-54 PF11744: ALMT" amino acids 403 to 585 (183 residues), 22.1 bits, see alignment E=9.9e-09 PF13515: FUSC_2" amino acids 412 to 534 (123 residues), 90.3 bits, see alignment E=1.7e-29

Best Hits

KEGG orthology group: None (inferred from 71% identity to phe:Phep_2166)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z4L1 at UniProt or InterPro

Protein Sequence (719 amino acids)

>CA265_RS09455 FUSC family protein (Pedobacter sp. GW460-11-11-14-LB5)
MQIRQPIRNIQDFLLSTYFADGLRITIGVLLPSLIFAQFGMLKYGMTLSLGALCVSVVDS
PGPMVHRRNAMLITTALIFTFSIITGLTNKNHYFIGFLLAVSSFVFSMFYIYGLRAASVG
TAVLLIMVLSIDDVRPWQEVLLHAVLILAGSLWYTGLSYFVYRLRPFRLVQQSLSDSILE
VAEFLREKAKFYHQNNNYDKTYSDLLQLQVAVHEKQDAVRELLFRTREIVRDSTPEGRFL
LLVFVDMVDLFEQVMSTYYNYQQLHDQFDKAGILSDYEMAIKRISYALDDIAFALKSGGT
PVVSKRLLIEIERLKIKINDLEKNNQNQEYNTLGIIALKNIEVNIENILARVKTIFSYFK
IRNSKDIRQAEVDTEKFITRQKFDFKLFTENLTYTSSTFRHSLRVTVVMLLGFIVAQILN
FSHSYWILLTILVISKPGFSLTKERNYQRLIGTTAGAFIGMGVITYIHDRNTLFIILLIC
MIGCYSFQRKNYVVSVLFMTPYILILFDFLGMGSIALARERIYDTFIGSGIALLASYSLF
PTWEHEKLKEAMVDILKANKAYYDQVIKLYFEKNYNRTEYKLARKEVYVSTANLASLFQR
MFSEPKSKQLFIKEVHQFTALSHLLSSYVATLSLYNKEHQFIFESFESLKPIANNTNYLL
DTSIDNLEKGTSTIDNVPLIRLNDTGLTIKKGEDLVPEQFDLIQKVAYDIYKLSVKIKL