Protein Info for CA265_RS09445 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: tetracycline resistance MFS efflux pump

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 transmembrane" amino acids 9 to 30 (22 residues), see Phobius details amino acids 50 to 68 (19 residues), see Phobius details amino acids 79 to 98 (20 residues), see Phobius details amino acids 104 to 125 (22 residues), see Phobius details amino acids 137 to 159 (23 residues), see Phobius details amino acids 165 to 185 (21 residues), see Phobius details amino acids 206 to 230 (25 residues), see Phobius details amino acids 250 to 272 (23 residues), see Phobius details amino acids 284 to 302 (19 residues), see Phobius details amino acids 308 to 329 (22 residues), see Phobius details amino acids 347 to 368 (22 residues), see Phobius details amino acids 374 to 396 (23 residues), see Phobius details PF06779: MFS_4" amino acids 5 to 175 (171 residues), 27.5 bits, see alignment E=4e-10 PF07690: MFS_1" amino acids 13 to 357 (345 residues), 176 bits, see alignment E=2.1e-55 amino acids 278 to 396 (119 residues), 35.9 bits, see alignment E=8.3e-13 PF13347: MFS_2" amino acids 42 to 328 (287 residues), 32.5 bits, see alignment E=7.4e-12 PF00083: Sugar_tr" amino acids 49 to 188 (140 residues), 49.9 bits, see alignment E=5e-17

Best Hits

KEGG orthology group: K08151, MFS transporter, DHA1 family, tetracycline resistance protein (inferred from 61% identity to sli:Slin_4881)

Predicted SEED Role

"Tetracycline efflux protein TetA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z491 at UniProt or InterPro

Protein Sequence (403 amino acids)

>CA265_RS09445 tetracycline resistance MFS efflux pump (Pedobacter sp. GW460-11-11-14-LB5)
MANGKKSAMSFIMVTLLIDFTGFGLIIPVLPKLIQDFTGGGFGLAAEYGGWLTLAYASVQ
FIFSPIIGAMSDRYGRRPVLLSSLFGLGIDYIFLAFAPSIVWLFVGRIIAGITGASFTTA
QAYIADVSPPEKRAQNFGLVGAAFGVGFILGPVLGGAFSHFGTRVPFMIAAGLSLVNWLY
GYFILPESLPVEKRRAFDWKRANPIGSLVSIGKYPALLGLMATLFLLYFASHSVQSNWTF
YTMEKFKWDAAWVGYSLGFVGLVVGLVQGGLIRVILPKIGEKKAVYFGLILYIIGFIAFA
FATKGWMMFAFMLPYGLAGICGPAMQGLISNQVPSNAQGEMQGVLTGLQSLAAIFAPWVM
THIFAYFIEGKAPVYFPGAPFILSAVLTLIGLFICLRSLKKYH