Protein Info for CA265_RS09125 in Pedobacter sp. GW460-11-11-14-LB5

Updated annotation (from data): Methylglutaconyl-CoA hydratase (EC 4.2.1.18)
Rationale: Specifically important for utilizing L-Leucine. Automated validation from mutant phenotype: the predicted function (4.2.1.18) was linked to the condition via a SEED subsystem. This annotation was also checked manually.
Original annotation: methylglutaconyl-CoA hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00378: ECH_1
  • amino acids 11 to 258 (248 residues), 190 bits, E=4.9e-60
• PF16113: ECH_2
  • amino acids 14 to 195 (182 residues), 102.9 bits, E=2.7e-33

Best Hits

KEGG orthology group: K13766, methylglutaconyl-CoA hydratase [EC: 4.2.1.18] (inferred from 73% identity to phe:Phep_2546)

MetaCyc: 31% identical to 3-methylglutaconyl-CoA hydratase (Pseudomonas putida)
Methylglutaconyl-CoA hydratase. [EC: 4.2.1.18]

Predicted SEED Role

"Enoyl-CoA hydratase (EC 4.2.1.17)" in subsystem Acetyl-CoA fermentation to Butyrate or Butanol Biosynthesis or Isoleucine degradation or Polyhydroxybutyrate metabolism or Valine degradation or n-Phenylalkanoic acid degradation (EC 4.2.1.17)

MetaCyc Pathways

• benzoyl-CoA biosynthesis (3/3 steps found)
• fatty acid β-oxidation II (plant peroxisome) (4/5 steps found)
• pyruvate fermentation to hexanol (engineered) (8/11 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (10/14 steps found)
• L-isoleucine degradation I (4/6 steps found)
• L-leucine degradation I (4/6 steps found)
• fatty acid salvage (4/6 steps found)
• methyl ketone biosynthesis (engineered) (4/6 steps found)
• pyruvate fermentation to butanol II (engineered) (4/6 steps found)
• adipate biosynthesis (3/5 steps found)
• adipate degradation (3/5 steps found)
• glutaryl-CoA degradation (3/5 steps found)
• fatty acid β-oxidation VI (mammalian peroxisome) (4/7 steps found)
• propanoate fermentation to 2-methylbutanoate (3/6 steps found)
• superpathway of Clostridium acetobutylicum acidogenic fermentation (5/9 steps found)
• valproate β-oxidation (5/9 steps found)
• fatty acid β-oxidation I (generic) (3/7 steps found)
• pyruvate fermentation to butanoate (3/7 steps found)
• 2-methyl-branched fatty acid β-oxidation (8/14 steps found)
• oleate β-oxidation (23/35 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (17/27 steps found)
• glycerol degradation to butanol (9/16 steps found)
• benzoate biosynthesis III (CoA-dependent, non-β-oxidative) (1/5 steps found)
• fatty acid β-oxidation IV (unsaturated, even number) (1/5 steps found)
• ferrichrome A biosynthesis (1/5 steps found)
• L-valine degradation I (3/8 steps found)
• pyruvate fermentation to butanol I (3/8 steps found)
• (8E,10E)-dodeca-8,10-dienol biosynthesis (5/11 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (10/18 steps found)
• benzoyl-CoA degradation I (aerobic) (2/7 steps found)
• L-glutamate degradation V (via hydroxyglutarate) (4/10 steps found)
• benzoate biosynthesis I (CoA-dependent, β-oxidative) (3/9 steps found)
• 3-phenylpropanoate degradation (3/10 steps found)
• phenylacetate degradation I (aerobic) (2/9 steps found)
• gallate degradation III (anaerobic) (3/11 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (4/13 steps found)
• L-glutamate degradation VII (to butanoate) (3/12 steps found)
• L-tryptophan degradation III (eukaryotic) (5/15 steps found)
• superpathway of phenylethylamine degradation (2/11 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (6/17 steps found)
• (4Z,7Z,10Z,13Z,16Z)-docosapentaenoate biosynthesis (6-desaturase) (3/13 steps found)
• docosahexaenoate biosynthesis III (6-desaturase, mammals) (3/14 steps found)
• crotonate fermentation (to acetate and cyclohexane carboxylate) (3/16 steps found)
• benzoate fermentation (to acetate and cyclohexane carboxylate) (3/17 steps found)
• toluene degradation VI (anaerobic) (3/18 steps found)
• platensimycin biosynthesis (6/26 steps found)
• Spodoptera littoralis pheromone biosynthesis (3/22 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Caprolactam degradation
• Fatty acid elongation in mitochondria
• Fatty acid metabolism
• Geraniol degradation
• Limonene and pinene degradation
• Lysine degradation
• Propanoate metabolism
• Tryptophan metabolism
• Valine, leucine and isoleucine degradation
• alpha-Linolenic acid metabolism
• beta-Alanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 4.2.1.17 or 4.2.1.18

Sequence Analysis Tools

See A0A1X9Z433 at UniProt or InterPro

Protein Sequence (258 amino acids)

>CA265_RS09125 Methylglutaconyl-CoA hydratase (EC 4.2.1.18) (Pedobacter sp. GW460-11-11-14-LB5)
MENLVLYQVAERIATITINRPEKKNALNPQLIAELTAAFIKASEDDLVKVVILNANGDAF
SAGADLAYLQQLQYNTFEENVADSNHLKKLFTTIYYLPKVVIAQVEGHAIAGGCGLATIC
DIVFATPESNFGYTEVKIGFVPAIVSCFLKEKVSESIAKEILLTGKIFSAEEALKYNLIN
FVTNSSDIHQIVREFALSLCSGSSGNSLMITKQLITQTTNPLLEKCLETAVQINARVRES
EDFKKGISSFLNKEKINW