Protein Info for CA265_RS09090 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: DNA ligase-associated DEXH box helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 825 TIGR04121: DEXH box helicase, DNA ligase-associated" amino acids 11 to 822 (812 residues), 1063.4 bits, see alignment E=0 PF00270: DEAD" amino acids 26 to 208 (183 residues), 88.1 bits, see alignment E=1.4e-28 PF04851: ResIII" amino acids 37 to 202 (166 residues), 29.4 bits, see alignment E=1.8e-10 PF00271: Helicase_C" amino acids 259 to 362 (104 residues), 49.9 bits, see alignment E=9e-17 PF19306: WH_Lhr" amino acids 390 to 554 (165 residues), 204.5 bits, see alignment E=1.9e-64 PF08494: DEAD_assoc" amino acids 607 to 793 (187 residues), 176.7 bits, see alignment E=1.2e-55

Best Hits

KEGG orthology group: K03724, ATP-dependent helicase Lhr and Lhr-like helicase [EC: 3.6.4.-] (inferred from 72% identity to phe:Phep_2563)

Predicted SEED Role

"FIG003033: Helicase domain protein"

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.-

Use Curated BLAST to search for 3.6.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z3L7 at UniProt or InterPro

Protein Sequence (825 amino acids)

>CA265_RS09090 DNA ligase-associated DEXH box helicase (Pedobacter sp. GW460-11-11-14-LB5)
MDQTKTKGYKKIKAWLKANKRKPFQFQEDAWQYYLDGYSGLVNAPTGFGKTFSLFLAVVI
EALNASEANNKKAKDRLQLIWITPLRSLAKDIARAMRETLLELELDWHVGVRNGDTSQAE
KLQQKKSMPEILLITPESLHLLLAQKGSSTLFRNLKCIVADEWHELLGSKRGVLVELAVS
RIKGLQKLEKNQFLRIWGISATIGNIEEALDVLEPNLEAKRIIVKADLEKKILIKSILPD
DIETLPWAGHLGLKLAYKLLPIIEKSKTTLIFINTRGQSEMWYQHLLNIEPELAGRIAIH
HGSIDFELRNWIEDALHTGQLKAVIATSSLDLGVDFKPVDTVVQVGSPKGVARFLQRAGR
SGHSPHEISKIYFLPTHALELVEAAAIKEAAKTNNIESREPFIMVFDTLVQYLVTLAIGD
GFDDKIIYEEIKHTHAFKMILPEEWTWVMQFITSGGDSLSAYTEFKKVVKDEDGLWKVKS
RQLAMRHRLHIGTIVSDAMLKVKFISGGYIGMVEEYFVTRLKAGDNFRLAGRVLEFIQVK
DMTVVVRVSKQKNAISPSWNGGRLPLSSNLGSVLRKKYNEALDKTHQDEELDAVYPLFLL
QEKRSHVPENDELLIELINNKEGFHLFAYPFEGRLVHEVLAALVAYRLSKLLPISFSIAM
NDYGFELLSETEIPMDESIAYEVFSPVNLTEDITLSINSTEMARRKFRDIACISGLVFQG
YPGKYVANKHLQSSAGLFFNVFSDYDKHNLLLRQAYDEVFYQQLEEPRLAAALDRIQHGA
IIITNPKSFTPLSFPIKVDSLRENMSSEELEQRIARMKAESEKIK