Protein Info for CA265_RS09085 in Pedobacter sp. GW460-11-11-14-LB5

Updated annotation (from data): DNA repair nuclease, ligase-associated (TIGR04123)
Rationale: Specifically important in stress Cisplatin. This family was previously annotated as a DNA ligase-associated metallophosphoesterase (TIGR04123). A member of this family (PdeM) has been studied biochemically and found to have nuclease activity, but it was not known if DNA was the physiological substrate (see PMC4320098).
Original annotation: phosphoesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 transmembrane" amino acids 177 to 194 (18 residues), see Phobius details TIGR04123: metallophosphoesterase, DNA ligase-associated" amino acids 4 to 211 (208 residues), 215.7 bits, see alignment E=2.2e-68 PF00149: Metallophos" amino acids 25 to 118 (94 residues), 32.6 bits, see alignment E=5.5e-12

Best Hits

KEGG orthology group: None (inferred from 53% identity to phe:Phep_2564)

Predicted SEED Role

"FIG006285: ICC-like protein phosphoesterase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z4D9 at UniProt or InterPro

Protein Sequence (212 amino acids)

>CA265_RS09085 DNA repair  nuclease, ligase-associated (TIGR04123) (Pedobacter sp. GW460-11-11-14-LB5)
MTITSQGEELILDKERALFLPKHQLLAISDLHLGKTAHFRQAGLQVPATLAQTDLQRLSL
LIKQYHPKTLLINGDMFHHGLNTDIDEFSAWRKQYQELNFLLVKGNHDRLSATNYAAMDI
EIHEPSFCLGPFCFIHDAPNCTEEELYPISGHVHPGVTIVGKAKQRLKFPCFYFGKDYAV
LPAFSLFTGLYTIYPKMNERIFAVTPKSVVEV