Protein Info for CA265_RS09065 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: competence/damage-inducible protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 TIGR00200: competence/damage-inducible protein CinA N-terminal domain" amino acids 2 to 411 (410 residues), 331 bits, see alignment E=1.4e-102 TIGR00177: molybdenum cofactor synthesis domain" amino acids 3 to 165 (163 residues), 97.1 bits, see alignment E=1.4e-31 PF00994: MoCF_biosynth" amino acids 4 to 169 (166 residues), 117.8 bits, see alignment E=4.8e-38 PF18146: CinA_KH" amino acids 179 to 251 (73 residues), 43.3 bits, see alignment E=4.8e-15 PF02464: CinA" amino acids 258 to 409 (152 residues), 188.2 bits, see alignment E=1.1e-59 TIGR00199: amidohydrolase, PncC family" amino acids 265 to 408 (144 residues), 165.3 bits, see alignment E=1.6e-52

Best Hits

Swiss-Prot: 34% identical to CINAL_DICTD: CinA-like protein (Dtur_0064) from Dictyoglomus turgidum (strain Z-1310 / DSM 6724)

KEGG orthology group: K03742, competence/damage-inducible protein CinA (inferred from 71% identity to phe:Phep_1871)

Predicted SEED Role

"Molybdopterin binding motif, CinA N-terminal domain / C-terminal domain of CinA type S" in subsystem NAD and NADP cofactor biosynthesis global

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z3H5 at UniProt or InterPro

Protein Sequence (414 amino acids)

>CA265_RS09065 competence/damage-inducible protein A (Pedobacter sp. GW460-11-11-14-LB5)
MLAEIITIGDEILIGQIVDTNSAWMAKQLNLIGVSVKQITSVSDDEQHIIEALELAEKRA
DIILITGGLGPTKDDITKKTLAKYFNMGFRNDAGALEMVRQIFEKYNRPLLDINIQQADV
PDGCEVIVNKNGTAPCMWFEQNDIIFVSMPGVPYEMMYLMDDEILPRIKSRFKLPFIVHK
TILTANIGESFLAKEIEEIEDSLPAHIKLAYLPKLGQVRLRLSAKGDNETALNQEVELYA
KQIISKVNKFVVTDEDIPLEKAILNLMKSKGLTLSTAESCTGGYIAHLITQHPGSSSVYW
GGAVAYAYELKESILGVKESTLTTFGAVSEQTVTEMAEGAITHFKTDYAIAVSGIAGPDG
GTEDKPVGTVWIAISSKHKTVAKVFNFSNKRIQNIERSAASALAMLLNLLKETV