Protein Info for CA265_RS08850 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 transmembrane" amino acids 82 to 102 (21 residues), see Phobius details amino acids 253 to 269 (17 residues), see Phobius details amino acids 276 to 297 (22 residues), see Phobius details amino acids 308 to 328 (21 residues), see Phobius details amino acids 347 to 371 (25 residues), see Phobius details PF12412: DUF3667" amino acids 53 to 97 (45 residues), 72.6 bits, see alignment 7.5e-25

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z3D4 at UniProt or InterPro

Protein Sequence (373 amino acids)

>CA265_RS08850 hypothetical protein (Pedobacter sp. GW460-11-11-14-LB5)
MSAGKYRKEHNCLNCGAHVEKHYCSDCGQPNLELKESFWAFISHSIAHYFHFDNKFFQTL
SPLLTKPGKVTLDYLAGKRARYINPVSMYIFVSIVYFLVVYSPKHKTKEKHENGITIENK
RSENVTDSVNKALKLTGISKEIANKATTSINKAIKKKEFVKLGFADQEKELNRLKTENTT
LKSDSINDLIEDFNEIHIERNDSTYAAYLNRQKKLPPADQDSWYERLIKKRAINIGEKSE
VIQETLEHNRPKQYFLLMPLLALFIMWNFRKNHIYYLNHLIFTIHGMTAYFIVQIFTNPL
VKHVFGNSAIITNIIQFGVVVWICWYMYNALKVFYQRKPSSIIFKMFWIFVMYWIAFNVS
EMVMVNLIYYVAT