Protein Info for CA265_RS08355 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: short-chain dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 PF00106: adh_short" amino acids 7 to 190 (184 residues), 163.2 bits, see alignment E=1.6e-51 PF08659: KR" amino acids 10 to 161 (152 residues), 65 bits, see alignment E=2.6e-21 PF01073: 3Beta_HSD" amino acids 10 to 122 (113 residues), 30.4 bits, see alignment E=6.4e-11 PF01370: Epimerase" amino acids 10 to 169 (160 residues), 32.7 bits, see alignment E=1.6e-11 PF13561: adh_short_C2" amino acids 16 to 250 (235 residues), 202 bits, see alignment E=3.3e-63

Best Hits

KEGG orthology group: None (inferred from 74% identity to fjo:Fjoh_4121)

Predicted SEED Role

"D-beta-hydroxybutyrate dehydrogenase (EC 1.1.1.30)" in subsystem Polyhydroxybutyrate metabolism (EC 1.1.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.30

Use Curated BLAST to search for 1.1.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z347 at UniProt or InterPro

Protein Sequence (254 amino acids)

>CA265_RS08355 short-chain dehydrogenase (Pedobacter sp. GW460-11-11-14-LB5)
MFSLKNKKAVVTGGGSGIGKAIATILAKQGAEVHIIELGTEHAQDTLDEIKTNGGVAFSY
GCDVSDHQAVAAVFNEIGNINILINNAGIAHIGKADTTDEADFDRVMRVNVKGVYNCLHA
AIPQIRLSGGGVIINMASIAALIGLPDRFVYSAAKGAVKAITMSVAKDYIGENIRCNSIS
PARVHTPFVDGFLQKNYPDNIPEMFEKLSKTQPIGRMAKPEEVGALALYLCSDEASFITG
CDYPIDGGFTTLNN