Protein Info for CA265_RS08350 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: ureidoglycolate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01557: FAA_hydrolase
  • amino acids 72 to 277 (206 residues), 254.2 bits, E=5.5e-80

Best Hits

Swiss-Prot: 54% identical to UGL_BURM1: Ureidoglycolate lyase (Bmul_3283) from Burkholderia multivorans (strain ATCC 17616 / 249)

KEGG orthology group: None (inferred from 70% identity to fjo:Fjoh_4120)

MetaCyc: 57% identical to 2,4-didehydro-3-deoxy-L-fuconate hydrolase (Burkholderia multivorans)
RXN-12096 [EC: 3.7.1.26]

Predicted SEED Role

"Predicted 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase" in subsystem Aromatic amino acid degradation or Benzoate transport and degradation cluster

MetaCyc Pathways

• L-fucose degradation III (5/8 steps found)
• L-rhamnose degradation III (2/7 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.7.1.26

Sequence Analysis Tools

See A0A1X9Z3G9 at UniProt or InterPro

Protein Sequence (284 amino acids)

>CA265_RS08350 ureidoglycolate lyase (Pedobacter sp. GW460-11-11-14-LB5)
MKLIRFGEAGAEKPGVIINDNYFDVSALVKDYNEEFFGGDGLEKLKTAVQSADLPQVDKG
VRLGPALARPSKIICVGLNYKDHAAETNAPIPSEPILFFKATSAIVGPNDDLIIPKNSKK
TDWEVELAIVIGKKASYVTEENALDHIAGYVLHNDYSEREFQIERNGQWVKGKSCDTFAP
IGPFIATQDEIADVHNLRLWLTVNGKTMQDGNTSNLIFNVPFMIAYISQFMTLLPGDVIT
TGTPAGVGLGQKPEPWYLKAGDVVELGIDGLGTSKQTAKAYSGN