Protein Info for CA265_RS08220 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: DNA mismatch repair protein MutS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 870 PF01624: MutS_I" amino acids 9 to 119 (111 residues), 126.1 bits, see alignment E=2e-40 TIGR01070: DNA mismatch repair protein MutS" amino acids 9 to 865 (857 residues), 902.6 bits, see alignment E=1.4e-275 PF05188: MutS_II" amino acids 130 to 255 (126 residues), 68.3 bits, see alignment E=2.4e-22 PF05192: MutS_III" amino acids 273 to 561 (289 residues), 147.1 bits, see alignment E=2.2e-46 PF05190: MutS_IV" amino acids 430 to 521 (92 residues), 95.3 bits, see alignment E=5.6e-31 PF00488: MutS_V" amino acids 616 to 804 (189 residues), 273.3 bits, see alignment E=3.1e-85

Best Hits

Swiss-Prot: 63% identical to MUTS_GRAFK: DNA mismatch repair protein MutS (mutS) from Gramella forsetii (strain KT0803)

KEGG orthology group: K03555, DNA mismatch repair protein MutS (inferred from 85% identity to phe:Phep_1883)

Predicted SEED Role

"DNA mismatch repair protein MutS" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z3Z6 at UniProt or InterPro

Protein Sequence (870 amino acids)

>CA265_RS08220 DNA mismatch repair protein MutS (Pedobacter sp. GW460-11-11-14-LB5)
MAKDTNKETPLMQQYNAIKAKYPGALLLFRVGDFYETFGEDAIKTAQILGIVLTRRGTGP
NGGALELAGFPHHSLDNYLSKLVRAGQRVAICDQLEDPKTTKTIVKRGVTELVTPGVAYG
DNIVNQKSNNFLACVFFDKTQLGVSFLDISTGEFLIAQGNSDYIDKLLQGFKPTEVIFQK
SKRQAFTENFGDRFYTFGLDEWPFTSDFGNETLMKHFEVSSLKGFGVERLQSGIVAAGVI
LHYLGETEHRNLQHISSIGRIEEDRYMWLDRFTIRNLELVNSPNDNAVTLFDILDHTCTP
MGARLLQKWIIMPLKELKPIQERLGMVEYFVKHEELQGEFLSNIKQIGDLERLISKVGLQ
RVGPRELVALKRALYHIEAVKKLAADSKNPFLIKIADQLNPCLAIRERIERELQPDPPAL
LIKGNVIADGIDEDLDRLRKIAFGGKDYLVQIQKREAEATGIPSLKIAFNNVFGYYLEVT
HTHKDKVPAGWIRKQTLVNAERYITPELKEYEDQILGAEEKIQAIEIRLYNELMYETASY
IKPIQLDSFLIAQLDCLLCFAQLAAKNHYNKPKVTENKVLDIKGGRHPVIEKQLPVGQEY
ITNDVYLDTDSQQIIMITGPNMAGKSAILRQTALIVLMAQMGSFVPAKDAEVGIVDKIFT
RVGASDNISSGESTFMVEMNETASILNNISDDSLILLDEIGRGTSTYDGISIAWAIAEFL
HQHPTARPKTLFATHYHELNELANTMPRIKNFNVSVKEMTNKVIFLRKLVPGGSEHSFGI
HVAKMAGMPTKLIGRANEILKKLEIDRTEGQSIKDSIKKVQNQAYQLQMFAIDDPVLVKI
RDTLNNLDVNALTPVEALLKLDEIQRLIKN