Protein Info for CA265_RS08200 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: aminofutalosine synthase MqnE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03700: putative menaquinone biosynthesis radical SAM enzyme, SCO4494 family
  • amino acids 23 to 374 (352 residues), 450.7 bits, E=3.1e-139
• TIGR00423: radical SAM domain protein, CofH subfamily
  • amino acids 67 to 373 (307 residues), 328.1 bits, E=5.7e-102
• PF04055: Radical_SAM
  • amino acids 75 to 248 (174 residues), 58.4 bits, E=1.1e-19
• PF19288: CofH_C
  • amino acids 258 to 375 (118 residues), 38.5 bits, E=9.7e-14

Best Hits

Swiss-Prot: 43% identical to MQNE_THET8: Aminodeoxyfutalosine synthase (mqnE) from Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)

KEGG orthology group: None (inferred from 76% identity to phe:Phep_1880)

MetaCyc: 43% identical to aminodeoxyfutalosine synthase (Thermus thermophilus HB8)
RXN-15264 [EC: 2.5.1.120]

Predicted SEED Role

"Gene SCO4494, often clustered with other genes in menaquinone via futalosine pathway" in subsystem Menaquinone Biosynthesis via Futalosine

MetaCyc Pathways

• 1,4-dihydroxy-6-naphthoate biosynthesis I (2/6 steps found)
• 1,4-dihydroxy-6-naphthoate biosynthesis II (1/5 steps found)
• superpathway of menaquinol-8 biosynthesis II (4/10 steps found)
• superpathway of menaquinol-8 biosynthesis III (3/9 steps found)
• superpathway of demethylmenaquinol-6 biosynthesis II (1/8 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.120

Sequence Analysis Tools

See A0A1X9Z322 at UniProt or InterPro

Protein Sequence (397 amino acids)

>CA265_RS08200 aminofutalosine synthase MqnE (Pedobacter sp. GW460-11-11-14-LB5)
MNTTEQVEKILADTNLSTELQNIAHKVLHGERITFDEGVYLYEHAELGYLGVLANFIREQ
KHGDKTYFNRNFHLEPTNLCVYDCKFCSYSRLIKQKEEGWALTMEQMLDIVKKYDGEPVT
EVHIVGGVLPQYDVAFYAALFTAIKQHRPDLHVKALTPVEYHYIFKKAKIDYATGMRLMK
EAGLESIPGGGAEIFHPEIREQIAKDKCTGQQWLDIHEEWHKLGMRSNATMLYGHIEKYW
HRVDHMEKLRELQDRTGGFQTFIPLKFRNQHNQMSNVPESSVIEDLRNYAIARIYMDNFD
HIKAYWAMISRETAQLSLNYGVDDIDGTLDDTTKIYSMAGAEEQTPAMSTKELVNLIKQV
GRKAIERDTLYNVVTDFEHVVFEEEKKPQYYKLPVVN