Protein Info for CA265_RS08080 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: thioesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 135 PF01643: Acyl-ACP_TE" amino acids 3 to 129 (127 residues), 26.3 bits, see alignment E=8.2e-10 TIGR00051: acyl-CoA thioester hydrolase, YbgC/YbaW family" amino acids 7 to 121 (115 residues), 97.7 bits, see alignment E=2.9e-32 PF13279: 4HBT_2" amino acids 10 to 130 (121 residues), 64.2 bits, see alignment E=2.4e-21 PF03061: 4HBT" amino acids 18 to 101 (84 residues), 51.3 bits, see alignment E=1.8e-17

Best Hits

Swiss-Prot: 37% identical to YNEP_BACSU: Putative acyl-CoA thioesterase YneP (yneP) from Bacillus subtilis (strain 168)

KEGG orthology group: K07107, acyl-CoA thioester hydrolase [EC: 3.1.2.-] (inferred from 64% identity to shg:Sph21_3071)

Predicted SEED Role

"4-hydroxybenzoyl-CoA thioesterase family active site" in subsystem Ton and Tol transport systems

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z371 at UniProt or InterPro

Protein Sequence (135 amino acids)

>CA265_RS08080 thioesterase (Pedobacter sp. GW460-11-11-14-LB5)
MYSHSTKIRVRYGETDQMGYMYYGNYAQYYEVGRVEMLRSLGMSYSSMEADGIMMPVLEL
KCKYIKPALYDQEITVKTIIKTLPGIRIFFEYELYNEKEELINIGETTLVFVDMKKNKPT
SPPENFMKKLSVFFN