Protein Info for CA265_RS07930 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: group 1 glycosyl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 transmembrane" amino acids 91 to 116 (26 residues), see Phobius details amino acids 137 to 153 (17 residues), see Phobius details PF13439: Glyco_transf_4" amino acids 15 to 151 (137 residues), 34.4 bits, see alignment E=4.4e-12 PF13477: Glyco_trans_4_2" amino acids 18 to 148 (131 residues), 29.3 bits, see alignment E=1.8e-10 PF00534: Glycos_transf_1" amino acids 184 to 343 (160 residues), 138 bits, see alignment E=4.7e-44 PF13692: Glyco_trans_1_4" amino acids 194 to 331 (138 residues), 104.6 bits, see alignment E=1.1e-33

Best Hits

KEGG orthology group: None (inferred from 47% identity to psn:Pedsa_0817)

Predicted SEED Role

"glycosyl transferase, group 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z3F3 at UniProt or InterPro

Protein Sequence (364 amino acids)

>CA265_RS07930 group 1 glycosyl transferase (Pedobacter sp. GW460-11-11-14-LB5)
MATKLCFVINSLEGGGAERVISNLANHFSDKNCSVTMICLNTAEVRYEINKKVKIVNLVE
RKGRHNLFNRLKYAYLTFYRLLTVLKKEKPVCTICFMTSANIWAGLCCVILGLPYLVSER
TAPVYTLDQYNRLLQWMVFHIYRKSKAIVLPAFEMFKGFKRIKQFETLYNFKTIHNPIHH
FSHANTGAVNSKRFILSVGRLCYEKGFDNLIEAYSKLELTDVDLLISGEGPDRASLEKQI
ADLNLKNKVKLIGFKSNLQDYYAQAEVFVLSSRSEGYPNVLVEAMGMGCACVAMDCEFGP
SEIIKHGINGLLVDKEDIVGLSLSIDKMLNNSFLRSEFSEKAKSINETNSIERISANWEQ
LIMS